DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANB1 and eEF5

DIOPT Version :9

Sequence 1:NP_012581.3 Gene:ANB1 / 853506 SGDID:S000003808 Length:157 Species:Saccharomyces cerevisiae
Sequence 2:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster


Alignment Length:152 Identity:93/152 - (61%)
Similarity:121/152 - (79%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


Yeast     1 MSDEEHTFENADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIF 65
            |::.:..||..|:|||.|||||||||||||||::|.||||||:|||||||||||||||:|.:|||
  Fly     1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65

Yeast    66 TGKKLEDLSPSTHNLEVPFVKRSEYQLLDI-DDGYLSLMTMDGETKDDVKAPEGELGDSMQAAFD 129
            :.||.||:.|||||::||.|||.:.||:.| ||.:|:|||..|:.::|:|.||||||:.::..||
  Fly    66 SNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFD 130

Yeast   130 EGKDLMVTIISAMGEEAAISFK 151
            .||||:.|::.|.|||..|:.|
  Fly   131 SGKDLLCTVLKACGEECVIAIK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANB1NP_012581.3 PLN03107 1..154 CDD:357685 93/152 (61%)
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 92/150 (61%)
eIF-5a 84..152 CDD:279611 33/67 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344396
Domainoid 1 1.000 138 1.000 Domainoid score I1051
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100947
Inparanoid 1 1.050 208 1.000 Inparanoid score I821
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53968
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm46920
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - LDO PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.