DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCN5 and Acf

DIOPT Version :9

Sequence 1:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae
Sequence 2:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster


Alignment Length:492 Identity:98/492 - (19%)
Similarity:157/492 - (31%) Gaps:222/492 - (45%)


- Green bases have known domain annotations that are detailed below.


Yeast    21 VKRVKLENNVEEIQPEQAETNKQEGTDKENKGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYT 85
            ||.:.|.|.       |.|.:|::.|.|:.|...|:|.:.      .||                
  Fly  1110 VKSLGLSNG-------QNEKDKKQATKKKRKFIVEEEDDE------ATD---------------- 1145

Yeast    86 FKERPSVVEENEGKIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV 150
                    ||.|.|.:..:.:.|...||           :|....:..:.........|.::..:
  Fly  1146 --------EEEEEKKDDDMTDEDAEHEN-----------EKHDEDVEDDESVTSTPSSSRVNGRI 1191

Yeast   151 IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADN 215
            :|:|.|       ||..:|         ::|.|        :..|.::.|.              
  Fly  1192 LRRPRT-------RPTSRR---------LTSKE--------IEEHAQEDVD-------------- 1218

Yeast   216 YAIGYFKKQGFTKEITLDKSIWMG--YIKD------------YEGGTL--MQCSMLPRIRYLDAG 264
                       :.:::.|.|:..|  .|:|            |:||.:  :||.:...:..:   
  Fly  1219 -----------SGDVSDDASLTAGEDTIEDESDEEKVCQKCFYDGGEIKCVQCRLFFHLECV--- 1269

Yeast   265 KILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNIKPIDPMTIPGLKEAGWTPEMDALAQRPKR 329
                                |:.||....|.    .|...||                 .|||:|
  Fly  1270 --------------------HLKRPPRTDFV----CKTCKPM-----------------PQRPRR 1293

Yeast   330 ------GPHD------------------------------------------------------- 333
                  |.||                                                       
  Fly  1294 RHSNMNGDHDRDEEEPKAKRPRNSLRLSIDKTARPSNGNNNNNNNNSSVNNNNHRRSGRRTNEHM 1358

Yeast   334 ----AAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIY 394
                ||:.::|.::..|.||||||:||...|||||:..||.||||:.::.||....||..|:.:.
  Fly  1359 PLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLS 1423

Yeast   395 DARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEI 431
            |.:|||.||.:||.|....|....:||:|..::.:::
  Fly  1424 DIQLVFRNCDLYNVEGNEIYDAGCQLERFVIDRCRDM 1460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCN5NP_011768.1 COG5076 77..439 CDD:227408 84/436 (19%)
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584 10/66 (15%)
Bromo_Acf1_like 1349..1463 CDD:99936 41/112 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.