DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCN5 and tbrd-1

DIOPT Version :9

Sequence 1:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae
Sequence 2:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster


Alignment Length:160 Identity:45/160 - (28%)
Similarity:74/160 - (46%) Gaps:31/160 - (19%)


- Green bases have known domain annotations that are detailed below.


Yeast   282 SKSHIVRPGLEQF-KDLNNIKPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQN 345
            |.|:...|..|.: :.:|.|  :.|..||.             ..||.|.      .|||.||::
  Fly     6 SNSNQPPPRNEPYLQPVNGI--VQPPVIPP-------------PNRPGRR------TNILEELKS 49

Yeast   346 -------HAAAWPFLQPVNKEE--VPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFN 401
                   :..::.|..||:...  ||||:..:|.||||||:..:|.:..|.:..:.:.|.:|:|:
  Fly    50 VLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFD 114

Yeast   402 NCRMYNGENTSYYKYANRLEKFFNNKVKEI 431
            ||.:||.|.:..|:....|.:.|..:::.|
  Fly   115 NCLLYNLEGSPVYQAGKLLMEAFYMRMESI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCN5NP_011768.1 COG5076 77..439 CDD:227408 45/160 (28%)
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 33/109 (30%)
Bromodomain 328..423 CDD:413371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.