DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCN5 and fs(1)h

DIOPT Version :9

Sequence 1:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae
Sequence 2:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster


Alignment Length:136 Identity:45/136 - (33%)
Similarity:75/136 - (55%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


Yeast   302 PIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDA--AIQNILTELQNHAAAWPFLQPVN--KEEVP 362
            |::|  :.|:.:    |.:...|:||.|..:..  .|:.::..:..|..:|||.|||:  |..:|
  Fly    13 PVEP--VNGIVQ----PPVIPPAERPGRNTNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLP 71

Yeast   363 DYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNK 427
            ||:..||:|||:.|::.:||:|.|...::.|.|...:||||.:||.........|..|||.|..|
  Fly    72 DYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQK 136

Yeast   428 VKEIPE 433
            ::.:|:
  Fly   137 IESMPK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCN5NP_011768.1 COG5076 77..439 CDD:227408 45/136 (33%)
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929 37/105 (35%)
COG5076 387..>593 CDD:227408
Bromo_Brdt_II_like 481..581 CDD:99930
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.