DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATCAY and RhoGAP92B

DIOPT Version :10

Sequence 1:NP_149053.1 Gene:ATCAY / 85300 HGNCID:779 Length:371 Species:Homo sapiens
Sequence 2:NP_650844.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster


Alignment Length:160 Identity:34/160 - (21%)
Similarity:53/160 - (33%) Gaps:56/160 - (35%)


- Green bases have known domain annotations that are detailed below.


Human     7 TLRMENVDV----KEEWQDEDLPRPLPEETGVELLGSPVEDT--------SSPPNTLNFNG---- 55
            ||:.:.:.|    |....:|:|.|     ...|::.||...|        .|||.| |.||    
  Fly   457 TLQKQKLFVEGKSKSNSSNENLDR-----NDSEVMESPRYGTLRRQKANAPSPPTT-NGNGIIMT 515

Human    56 ----AHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLD-------INVDDIETPDETDSLEF 109
                :||.....:.|:                  .||:..:       .|:...::|..:...: 
  Fly   516 TSQTSHRPHAKELFPQ------------------QTPEKQEKPAKPPLPNLPQFQSPAASQPTQ- 561

Human   110 LGNGNELEWEDDTPVATAKNMPGDSADLFG 139
                .:||.....||..||.:|......||
  Fly   562 ----TQLEPLPPPPVTPAKPVPMTRTQFFG 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATCAYNP_149053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 16/58 (28%)
BNIP2 59..187 CDD:463609 14/88 (16%)
Required for interaction with KLC1. /evidence=ECO:0000250 115..120 2/4 (50%)
CRAL_TRIO_2 189..326 CDD:463965
Mediates interaction with GLS. /evidence=ECO:0000269|PubMed:16899818 190..371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..371
RhoGAP92BNP_650844.1 BAR 27..257 CDD:472257
RhoGAP_nadrin 245..452 CDD:239851
PRK13855 495..>650 CDD:172376 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.