DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:417 Identity:110/417 - (26%)
Similarity:199/417 - (47%) Gaps:41/417 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   124 FYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLASE 184
            ||:.::..|...|....|.||...|..|||.|..    |:....:|:..|...:..:|   .|::
  Fly   105 FYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSK---TAAD 166

Human   185 GSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVSKRHHEILLHID-FLY 247
            ....|::.:.::..|.|.:..|.|..:.:....| :|:::  :...|:...|:..:|   | ||:
  Fly   167 RGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--IGKRAITEHRYGNML---DIFLF 226

Human   248 YLTPDGQRFRRACRL--VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLL------- 303
            ......:|.|....:  ..||...:::|.        :|  .:.:.|.|..||:|.|:       
  Fly   227 GFPKLSRRLRLKLNIQEAEDFYTKIVRET--------ID--YRLRTKEKRNDFMDSLIEMYKNEQ 281

Human   304 LSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPK 368
            ....|||  |:..::.|:|..|...|.:|:::.:.:.||.||::.:.|::.|:|:..:. .:..|
  Fly   282 SGNSEDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNK 343

Human   369 EIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR-VIPKGIICLISVFGTHHNPA 432
            |..::.:..:.:|...:.|:||.:|.:..::|....|....|.: .|.||.|.:|...|.|::|.
  Fly   344 EFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPD 408

Human   433 VWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTL--LRFRVLPDH 495
            ::|:||::.|.||..|.|..|....::||..|||||||..|.|.:..|.||..:  .:|.|.|:.
  Fly   409 IYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPET 473

Human   496 TEPRR--KPELVLRAEGGLWLRVEPLS 520
            ..|.:  ...:::.||.|:.|:||.|:
  Fly   474 QIPMKIVVKNILISAENGIHLKVEKLA 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 106/410 (26%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 103/393 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.