DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:550 Identity:158/550 - (28%)
Similarity:267/550 - (48%) Gaps:79/550 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    19 WLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWG----------HQGMVNPTEEG 73
            |::|    .::|...:...||......||.|..      |.|.|          ||....|||  
  Fly     2 WIVL----CAFLALPLFLVTYFELGLLRRKRML------NKFQGPSMLPLVGNAHQMGNTPTE-- 54

Human    74 MRVLTQLVATYPQ----GFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGD 134
              :|.:....:.:    .|:.|:|..|.:: :.:|..:..::::...|:..|  .|....||||.
  Fly    55 --ILNRFFGWWHEYGKDNFRYWIGYYSNIM-VTNPKYMEFILSSQTLISKSD--VYDLTHPWLGL 114

Human   135 GLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMT 199
            |||.|.|.||.:||:|:|||||||||:.:.::.||:......:.:.:| :|....|..|....:|
  Fly   115 GLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVA-DGGNIFDFQEEAHYLT 178

Human   200 LDSLQKCVFSFDSHCQE-KPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLV 263
            ||.:.........:..| :.|..:.|..:::..:..|.........:|::..|:...:.:..:.:
  Fly   179 LDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTL 243

Human   264 HDFTDAVIQER---RRTLPSQGV--DDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEAD 323
            .|||:.:|.:|   |::....|:  |:|     ..|.:.|:|.||.|| .||:.|:.:::..|..
  Fly   244 QDFTNEIIAKRIEVRKSGLEVGIKADEF-----SRKKMAFLDTLLSSK-VDGRPLTSQELYEEVS 302

Human   324 TFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELL-KDREPKEIEWDDLAHLPFLTMCMKE 387
            ||||||||||.||:.:.:|.|::||:.||:...|..::: .....::..:.:::.:..|.:.:||
  Fly   303 TFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKE 367

Human   388 SLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKE 452
            :.||:|.||.|.|...:|.|: ||.::|||....:.:....:|..|:.||..:.|.|||.|   :
  Fly   368 AQRLYPSVPFIGRFTEKDYVI-DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDRE---K 428

Human   453 RSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLP------------------------ 493
            ..|..::||||||||||||.||:.|:|.|::..:..|.|||                        
  Fly   429 PGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKK 493

Human   494 -----DHT-EPRRKPELVLRAEGGLWLRVE 517
                 :|. :|.....:.|::|.||.||::
  Fly   494 SRDAHNHKYDPILSASMTLKSENGLHLRMK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 8/37 (22%)
p450 52..515 CDD:365848 148/513 (29%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 138/452 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.