DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:450 Identity:164/450 - (36%)
Similarity:252/450 - (56%) Gaps:35/450 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    89 KVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFF-----YSFLEPWLGDGLLLSAGDKWSRHR 148
            :||.| .:|.:.|..|:.:..::|:       .||.     |.:|.||||:|||.|...||...|
  Fly    99 RVWQG-TAPRVLLFEPETVEPILNS-------QKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRR 155

Human   149 RMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSH 213
            ::|||||||.||..::.:|||...::..|  |....||...::|.:::|.|||.:.:.......:
  Fly   156 KILTPAFHFKILDDFIDVFNEQSAVLARK--LAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIY 218

Human   214 CQ-EKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRT 277
            .| ...|||:.|:..:.::|..|..:|.|..||::.||.:.:..:.....:|.|::.||:||:..
  Fly   219 AQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAE 283

Human   278 LP---------SQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTT 333
            |.         :....|......|.|.|.|:| ||:...::|..||:||||.|.|||||||||||
  Fly   284 LAILQENNNNNNNNAPDAYDDVGKKKRLAFLD-LLIDASKEGTVLSNEDIREEVDTFMFEGHDTT 347

Human   334 ASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVI 398
            ::.:||.|:.|..|||||||..:|:..:..|.:.......:|..:.:|..|:|:||||.|.||::
  Fly   348 SAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMM 412

Human   399 SRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSA 463
            :|.|.:|:.: .|:::|.|...:|..:..|.||.|:|.||.::|..|.|||...|.|.|:|||||
  Fly   413 ARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSA 476

Human   464 GPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKP-----ELVLRAEGGLWLRVEP 518
            ||||||||.||:.|.|.|::..|.::::   ....||:.     ||:||.:.||.:::.|
  Fly   477 GPRNCIGQKFAILEEKAVISTVLRKYKI---EAVDRREDLTLLGELILRPKDGLRVKITP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 163/445 (37%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 163/446 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.