DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:408 Identity:104/408 - (25%)
Similarity:182/408 - (44%) Gaps:39/408 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   125 YSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACL 189
            |..::.||..|:|:...::|.:...:::..|....|:..:.:.......:..|  |.........
  Fly   101 YELMKDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQK--LAKQADQKVF 163

Human   190 DMFEHISLMTLDSLQKCVFSFDSHCQEKPS-EYIAAILELSALVSKRHHEILLHIDFLYYLTPDG 253
            |::..:|.:.||.:..      :.|..||| ||...:.:||.:..||...:.....|.|:|:...
  Fly   164 DIWYTVSPIVLDLMVM------TTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPF 222

Human   254 QRFRRACRLVHDFTD------AVIQERRRTLPSQGVDDF-LQAKAKSKTLDFIDVLLLSKDEDGK 311
            .| :|..||:....|      |:.|.:.:.....|:|.: |:..........:::||.|||   .
  Fly   223 MR-KRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESKD---P 283

Human   312 KLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLA 376
            :|:.|:|..|.:|..:.|:...:..|.:.|..:|::|..|::|..|    |...:.|:..| ||.
  Fly   284 QLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDE----LNLAQIKDQGW-DLE 343

Human   377 HLPFLTMCMKESLRLHPPVPVISRHVTQDI-----VLPDGRVIPKGIICLISVFGTHHNPAVWPD 436
            .|.:|...:.|::||:||..::.|.:.:|.     ::.|.. :|.|....|:::....|...:|.
  Fly   344 KLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAE-LPCGSEIYINLYELQRNEVRYPK 407

Human   437 PEVYDPFRF-DPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRR 500
            ...:|..|| |       ||...:.:|.|||.|..:.|:|..:|.:||..|..|.|||...|.|.
  Fly   408 ANHFDAQRFLD-------SPPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVRL 465

Human   501 KPELVLRAEGGLWLRVEP 518
            ...|||.:..|..|.::|
  Fly   466 DLRLVLGSSNGFQLALKP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 102/403 (25%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 98/389 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.