DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:444 Identity:105/444 - (23%)
Similarity:190/444 - (42%) Gaps:72/444 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    97 PLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLG--DGL---------LLSAGD-KWSRHRR 149
            ||..|..|::||.|         ..|.|.:|.....|  :|.         |||..| :|.:.|.
  Fly    81 PLYYLSDPELIRQV---------GIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRS 136

Human   150 MLTPAFHFNILKPYMKIFN----ESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSF 210
            .|||.|....::...::.:    |:|:.:    |.....|::.|::.:..:..|.|.:....|..
  Fly   137 TLTPTFTSLKIRQMFELIHFCNVEAVDFV----QRQLDAGTSELELKDFFTRYTNDVIATAAFGI 197

Human   211 DSHCQEKP-SEYIAAILELSALVSKRHHEILLHI-------------------DFLYYLTPDGQR 255
            ..:..:.| :|:.:....:|........:::|:|                   |:...|.....:
  Fly   198 QVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVDYFKKLVFGAMK 262

Human   256 FRRACRLVH-DFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIR 319
            :|:...:|. |....:::.:|:....|      :..|:|           :..:|..:.:|:|:.
  Fly   263 YRKEQSIVRPDMIHLLMEAQRQFKAEQ------EGSAES-----------AAQQDKAEFNDDDLL 310

Human   320 AEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMC 384
            |:...|...|.:|.|:.||:..|.|..:||.||:...|:..:.:....|.:::|.|..:.:|...
  Fly   311 AQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKPLDYDTLMGMKYLNCV 375

Human   385 MKESLRLHPPVPVISRHVTQDIVLPD--GRVI---PKGIICLISVFGTHHNPAVWPDPEVYDPFR 444
            :.||||..||..::.|....|..|.|  |.|:   .:..:..|:|...||:|..:|:||.:.|.|
  Fly   376 VSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPER 440

Human   445 FDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP 498
            ||.|:..|.....::||..|.|:|||...|:.|:|.::...:||:.:.|....|
  Fly   441 FDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTDRTP 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 105/444 (24%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 105/444 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.