DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp4aa1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster


Alignment Length:519 Identity:151/519 - (29%)
Similarity:259/519 - (49%) Gaps:57/519 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLLVGASWLLAHVLAWTYAFYDNCR----------RLRCFPQPPRRNWFWGHQGMVNPTEEGM 74
            |:||::..|         .|.||....          ||...|..|    |.|:..:|...:...
  Fly    19 LILLVISLS---------IYTFYATLNTYLRSVLLSLRLTGPPSLP----FLGNCMLVTDKDLMR 70

Human    75 RVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLS 139
            |...:....|....::|: .:.|..::..|:.::.::  |:.......|||..:..:|||||:.|
  Fly    71 RCAGKAFDLYGSLVRIWV-LLFPFFAVLEPEDLQVIL--SSKKHTNKVFFYRLMHNFLGDGLITS 132

Human   140 AGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSAC-LDMFEHISLMTLDSL 203
            :|.|||.|||::.||||.|:|:.::..|   |:...:.::.|.:|.... :::.::::...||.|
  Fly   133 SGSKWSNHRRLIQPAFHHNLLEKFIDTF---VDASQSLYENLDAEAVGTEINIAKYVNNCVLDIL 194

Human   204 QKCVFSFDSHCQEKPSEYIAAILELS------ALVSKRHHEILLHIDFLYYLTPDGQRFRRACRL 262
            .:.|.....    |......|::|.|      .::..|..:..|.:|.:|:.|..........:.
  Fly   195 NEAVLGVPI----KKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLLDGIYHWTKMANDELNQKKR 255

Human   263 VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMF 327
            ::|||..:||.||:      :.:.....::.|.|  :| .::...|..:..::|||..||.|||.
  Fly   256 LNDFTRKMIQRRRQ------IQNNNNGNSERKCL--LD-HMIEISESNRDFTEEDIVNEACTFML 311

Human   328 EGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKD--REPKEIEWDDLAHLPFLTMCMKESLR 390
            .|.|:..:.:::.|:.|.::||.|:||..|:..:.:|  |.|   ...||..:.::.||:||:||
  Fly   312 AGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAP---TMTDLHEMRYMEMCIKEALR 373

Human   391 LHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSP 455
            |:|.||:|:|.:.:::.|.. ..:|.|....|..:.||....::||||.:.|.||.|||.:.|.|
  Fly   374 LYPSVPLIARKLGEEVRLAK-HTLPAGSNVFICPYATHRLAHIYPDPEKFQPERFSPENSENRHP 437

Human   456 LAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLP--DHTEPRRKPELVLRAEGGLWLRVE 517
            .||:|||||||.|||..||:.|:|.:::..|..:::||  ..|.......:.|||.||||:|::
  Fly   438 YAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFRITLRASGGLWVRLK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 11/46 (24%)
p450 52..515 CDD:365848 141/473 (30%)
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 131/451 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.