DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:557 Identity:146/557 - (26%)
Similarity:251/557 - (45%) Gaps:103/557 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 LGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEG 73
            :|::.|..:  ::::|||  :||   |.|..|.:                 :|  |.:..|.||.
  Fly     1 MGVYSVLLA--IVVVLVG--YLL---LKWRRALH-----------------YW--QNLDIPCEEP 39

Human    74 MRVLTQL--VATYPQGFKVWM---------GPISPLLSLCHPDIIRSVINASAAIAPK------D 121
            ..::..|  |.|......:||         ||.:.......|.|:...|:.:..|..|      |
  Fly    40 HILMGSLTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTD 104

Human   122 KFFYSFLE--PWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYM-----KIFNESVNIMHAKWQ 179
            :.||...|  |..|. |.|..|.||...|..|:..|....:| ||     |:.:|.:.:...   
  Fly   105 RGFYHNTEDDPLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMK-YMFPTVVKVGHEFIEVFGQ--- 164

Human   180 LLASEGSACLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVSKRHHEILLHI 243
              |.|.|..:::.:.::..|.|.:..|.|..: |..::..:|:  .::...|:..:||..|  .|
  Fly   165 --AMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRHGPI--GI 223

Human   244 DFLYYLTPDGQRFRRACRLVHDFTDAVIQER--------RRTLPSQGVDDFLQAKAKSKTLDFID 300
            .|:       ..|:...|.:|  ....::|.        |.|:.       .:.|...:..||:|
  Fly   224 AFI-------NSFQNLARRLH--MKITLEEAEHFFLRIVRETVA-------FREKNNIRRNDFMD 272

Human   301 VLL------LSKDEDGK--KLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQE 357
            .|:      |:|.|.|:  .|:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|:|
  Fly   273 QLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKE 337

Human   358 VQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR---VIPKGII 419
            .||:: .:...||.::.:..:.:|...:.|:|||:..:||::|...:|..:| |.   ||.||:.
  Fly   338 CQEVI-GKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMP 400

Human   420 CLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLAL 484
            .||.....|.:..::.:|..::|..|.||.:|||..:.::||..|||||||..|...:.:..|||
  Fly   401 VLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLAL 465

Human   485 TLLRFR--VLPDHTEP--RRKPELVLRAEGGLWLRVE 517
            .:.||:  |....|.|  ..|...::.:|.|::|:||
  Fly   466 LINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 10/47 (21%)
p450 52..515 CDD:365848 133/510 (26%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 131/492 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.