DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp4p3

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster


Alignment Length:536 Identity:169/536 - (31%)
Similarity:257/536 - (47%) Gaps:71/536 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLLVGASWLLAHVLAWTYAF-YDNC------RRLRC-FPQPPR------------RNWF--WG 62
            |:|.||||..:|   :.|.|.. .|.|      :|:|. ..|.|.            .|.|  :|
  Fly     2 LILWLVGAFIVL---IQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFDLYG 63

Human    63 --HQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFY 125
              |.|:...:.:..:.|.:..|.|..|..::        ::...|....|:|....|  .....|
  Fly    64 KDHSGVFEHSRDCAKKLGKSYAEYAMGTAIY--------NVIDADSAERVLNDPNLI--NKGTIY 118

Human   126 SFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIF-NESVNIMHAKWQLLASEGSACL 189
            .||.|:|..|||.|.|.||...|:||:|.||||||..:.:|| .||:..:    :.......|.:
  Fly   119 DFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIFITESLKFL----EQFKGNDEAII 179

Human   190 DMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDG 253
            .:.|.|...||:|:.:...... ....||...|.....::.....:|....||..|.|:.:..: 
  Fly   180 SLNEVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWSDTLFKMFAE- 243

Human   254 QRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLD-----------FIDVLLLSKD 307
            :.:..|..:||.|:..:|.:||..|     :|.:.::..::|.:           .:|.|:|: :
  Fly   244 KDYASALDVVHGFSSEIIAKRRDQL-----NDEIDSRGNTQTAEDELFTSKKRFAMLDTLILA-E 302

Human   308 EDGKKLSDE-DIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIE 371
            :||  |.|. .|..|.||.||||:|||:.||.:.|.:::.:||.||:|.||:|..:.| |...:.
  Fly   303 KDG--LIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDD-ELNILN 364

Human   372 WDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPD 436
            ...|..|..|...:||::||.|.||.:.|..|::..|.:|.::|||....:.||..|.||..|..
  Fly   365 IGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRNPEYWDS 429

Human   437 PEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRK 501
            ||.:.|.||.|||.:.|...|:||||||.||||||.|||.|||.::...|.:|::||: .:|:  
  Fly   430 PEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMVALLKQFQILPE-IDPK-- 491

Human   502 PELVLRAEGGLWLRVE 517
               .:..:.||.||.:
  Fly   492 ---TIVFQTGLTLRTK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 15/56 (27%)
p450 52..515 CDD:365848 154/492 (31%)
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 154/481 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.