DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:467 Identity:103/467 - (22%)
Similarity:180/467 - (38%) Gaps:86/467 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    96 SPLLSLCHPDIIRSVI--------NASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLT 152
            :|:::|..|::|:.|.        |....|...|:.|        .|.|.:....:|...|..||
  Fly    79 TPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLF--------NDMLSVMRDQRWKHMRNTLT 135

Human   153 PAFHFNILKPYMKIFNES----VNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSH 213
            |.|....::....:.|||    :..:.:..:.|.......:||....:.::.|.:....|....:
  Fly   136 PVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVN 200

Human   214 CQEKPSEYIAAI--------------LELSALVSKRHHEILL------HIDFLYYLTPDGQRFRR 258
            ..:.|......|              ..||.||.|....:.|      .:|:...|..:..::| 
  Fly   201 SYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYR- 264

Human   259 ACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEAD 323
                         ::...|.|                 |.|.:|:.:|:|...|.:|::|.|:..
  Fly   265 -------------EKHNITRP-----------------DMIQLLMEAKNESEDKWTDDEIVAQCF 299

Human   324 TFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKES 388
            .|.|...:..::.:....|.|..:|:.|||..:|:.|..|......:.:|.:..:.::.|.:.||
  Fly   300 IFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISES 364

Human   389 LRLHPPVPVISRHVTQDIVL--PDGRVI---PKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPE 448
            ||.........|..::|..|  .||..:   ..|....|.:.|.|.:...:|:|..:||.||..|
  Fly   365 LRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEE 429

Human   449 NIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKPELVLRAEG--- 510
            ...:..|..::||..|||||||..:|:.::|.:|...||.:::   ...||...:|...|.|   
  Fly   430 RKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLWGSASGFNF 491

Human   511 ----GLWLRVEP 518
                |.|:.:.|
  Fly   492 TPRSGFWMHLVP 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 102/462 (22%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 96/440 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.