DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:456 Identity:100/456 - (21%)
Similarity:178/456 - (39%) Gaps:68/456 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    96 SPLLSLCHPDIIRSVI--------NASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLT 152
            :|::.:..|.:|:.:.        |......|.::.        :.|.|.:.....|...|.:||
  Fly    79 TPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERL--------VNDMLNVMRDQHWRNMRSVLT 135

Human   153 PAFHFNILKPYMKIFNES----VNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVF----- 208
            |.|....::....:.|||    :..:.:...:.|.|.:..|||....:.::.|.:....|     
  Fly   136 PVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVN 200

Human   209 SFDSHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYY----LTPDGQRFRRACRLVHDFTDA 269
            |||.  .|.....|...|..|.           .:.||.:    |.|....|.:.  .:.|.|:.
  Fly   201 SFDD--PENEFHTIGKTLAFSR-----------GLPFLKFMMCLLAPKVFNFFKL--TIFDSTNV 250

Human   270 VIQERRRTLPSQGVDDFLQAKAKSKTL--DFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDT 332
            ....|.       |.|.:|.:.|....  |.|.:|:.:|.|.....:|::|.|:...|.|...:.
  Fly   251 EYFVRL-------VVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFEN 308

Human   333 TASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPV 397
            .::.:....|.|.::.:.|||..:||:|..:..:...:.:|....:.::.|.:.||||.......
  Fly   309 NSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAA 373

Human   398 ISRHVTQDIVLPDGR-----VIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLA 457
            ..|...:|..|.|..     ....|....|.:.|.|.:...:|.|:.:||.||.....|:..|..
  Fly   374 ADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYT 438

Human   458 FIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKPELVLRAEG-------GLWLR 515
            ::||..|||:|||..:|:.:.|.:|...:|.:::   ...||...::...|.|       |.|::
  Fly   439 YLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI---EASPRTTRDMWESARGFNIIPTTGFWMQ 500

Human   516 V 516
            :
  Fly   501 L 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 100/453 (22%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 95/431 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.