DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:559 Identity:127/559 - (22%)
Similarity:221/559 - (39%) Gaps:143/559 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     9 LGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEG 73
            :.||...|             |||.:|||...   .|.||           .|...|.....::.
  Fly     5 IALWACGA-------------LLAVLLAWQQR---KCWRL-----------IWQLNGWRGVIQQP 42

Human    74 MRVLTQLVATYPQG-------FKV-WMGPIS------PLLSLCHPDIIRSVINASAAIAPKDKFF 124
            :..|...:..:|..       ::| :..|::      .||.:..|..:..|:||...:   ||  
  Fly    43 VLWLLLCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECL---DK-- 102

Human   125 YSFLEP--WLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL------L 181
             :||:.  ::..|||.:.|.||...|:.|.|||..||:..:..:||...|.|..::|.      .
  Fly   103 -TFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQ 166

Human   182 ASEGSACLDMFE----HISLMTLDSLQKCVFSFDSHCQEKPSEYIA----AILELSAL-VSKRHH 237
            |.:.:|..|:..    .:|.:|       :....::..:....:||    .:||:||: |.|...
  Fly   167 AVKFTAAEDLLSRAVLEVSCLT-------IMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWL 224

Human   238 EI-LLHIDFLYYLTPD-GQRFRRACRLVHDFTDAVIQERRRTL--------------PSQG---- 282
            :| |||    ..|.|: .:..::..:|:.||...:::.:.|..              .|.|    
  Fly   225 QIRLLH----RLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRR 285

Human   283 --VDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLA 345
              ::...|..|..                  :::.|:|..||.:.:....:|.::.:...|..||
  Fly   286 IFIEQIFQLAANG------------------EMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLA 332

Human   346 KHP-EYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLP 409
            .:. :.|.|...|::.|:.|  ..::..:.|..|.:|...:.|||||...||:..|||::|..|.
  Fly   333 TNKGDCQRRLLAEIRALVPD--VGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA 395

Human   410 DGR----VIPKGIICLISVFGTHHNPAVW-PDPEVYDPFRF---DPENIKE-------------- 452
             ||    ::|:..|.::..|....:...| .:...:||.||   :.|.:.:              
  Fly   396 -GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQR 459

Human   453 --RSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRF 489
              |...:|:|||.|.|:|||:.:.:..|||.|...:..|
  Fly   460 DRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 12/47 (26%)
p450 52..515 CDD:365848 115/516 (22%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 113/495 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.