DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:517 Identity:176/517 - (34%)
Similarity:286/517 - (55%) Gaps:31/517 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    21 LLLLVG---ASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF-WGHQGMVNPTEEGMRVLTQLV 81
            :.|::|   ||.|...:|.:...|......:...|.||..... .||..:..|..|.::.:.:.:
  Fly     1 MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKKIFEFM 65

Human    82 ATY--PQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKF-FYSFLEPWLGDGLLLSAGDK 143
            .||  .|..|||:||...:| :.:|..:..|:   ..:...||. .|..|||||.:|||:|.|.|
  Fly    66 ETYSKDQVLKVWLGPELNVL-MGNPKDVEVVL---GTLRFNDKAGEYKALEPWLKEGLLVSRGRK 126

Human   144 WSRHRRMLTPAFHFNILKPYMKIFNE-SVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCV 207
            |.:.|:::||||||.||..::::|.: |.:::....|.....|.:...:::.|:|.|:|::.:..
  Fly   127 WHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWINLCTMDTICETA 191

Human   208 FSFDSHCQEK-PSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVI 271
            .....:.|.. .|||:.|:..:|.::.||...||...|..|.|||..:..::|..::|.||:.:|
  Fly   192 MGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLHQFTEKII 256

Human   272 QERRRTLPSQG-----VDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHD 331
            .:||..|..:|     .:|.....||.| :.|:|:||.| ..|.:.||:.|||.|.|||||||||
  Fly   257 VQRREELIREGSSQESSNDDADVGAKRK-MAFLDILLQS-TVDERPLSNLDIREEVDTFMFEGHD 319

Human   332 TTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVP 396
            ||:|.|.:..|::|.|||.|::|.:|::.::.:.:...:.::.|..|.::.:|:||:||::|.||
  Fly   320 TTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVP 384

Human   397 VISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKER-SPLAFIP 460
            ::.|.|.:|..: :|::||.|....||.........::.:|.::.|.|||.....|: :|.|:||
  Fly   385 LLGRKVLEDCEI-NGKLIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTAEKLNPYAYIP 448

Human   461 FSAGPRNCIGQTFAMAEMKVVLALTLLRFRV--LPDHTEPRRKP----ELVLRAEGGLWLRV 516
            |||||||||||.|||.|:|.::|..|..:.|  :.|.:||   |    ||:||.:..|..:|
  Fly   449 FSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEP---PVLIAELILRTKEPLMFKV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 10/38 (26%)
p450 52..515 CDD:365848 168/480 (35%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 168/481 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.