DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F2 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:552 Identity:150/552 - (27%)
Similarity:266/552 - (48%) Gaps:54/552 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     2 SQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFY-DNCRRLRC---FPQPPRRNWF-W 61
            |..|.:.||..|      :|..|||.  |:|..|   |.:: .|.|..|.   .|.||..... .
  Fly    15 SSSSTTVLGFSP------MLTTLVGT--LVAMAL---YEYWRRNSREYRMVANIPSPPELPILGQ 68

Human    62 GHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYS 126
            .|........|.:.|....:..|.:..|.|:|.:. |:.|.:|..|..:::....:...::  |.
  Fly    69 AHVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVL-LVFLTNPSDIELILSGHQHLTKAEE--YR 130

Human   127 FLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDM 191
            :.:||.|||||:|.|..|..||:|:.|.||.:|||.::..|.:....:.|:..|   |.....|:
  Fly   131 YFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGL---EAGKSFDV 192

Human   192 FEHISLMTLDSLQKCVFSFDSHCQ-EKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQR 255
            .:::|..|:|.|...........: .|..||..|::::..::.||..::|..:|.:|..|...::
  Fly   193 HDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREK 257

Human   256 FRRACRLVHDFTDAVIQERRRTLPSQG-------------------------VDDFLQAKAKSK- 294
            ..|...::...|..|:::|:.....:.                         :||..:....:| 
  Fly   258 GDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKR 322

Human   295 TLDFIDVLL-LSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEV 358
            .|..:|.:: ::|:.| .:.:::||..|.:|.||||||||::|.|:.|..:..|.:.|.:...|.
  Fly   323 RLALLDAMVEMAKNPD-IEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQ 386

Human   359 QELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDG-RVIPKGIICLI 422
            :.:..|...::..:.|...:.:|...:.|:|||:||||:|:|.:..|:.|..| ..:|||...::
  Fly   387 KAIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIV 451

Human   423 SVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLL 487
            ..:..|..|.::|:|..:||..|.||.:..|...:|||||||||:|:|:.:||.::||:|:..:.
  Fly   452 LQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVR 516

Human   488 RFRVLPDHTEP--RRKPELVLRAEGGLWLRVE 517
            .:.|....||.  :.:.:::|:.|.|..:.:|
  Fly   517 NYIVHSTDTEADFKLQADIILKLENGFNVSLE 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 18/56 (32%)
p450 52..515 CDD:365848 133/494 (27%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 127/466 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.