DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAL31 and CG33282

DIOPT Version :9

Sequence 1:NP_009857.1 Gene:MAL31 / 852601 SGDID:S000000502 Length:614 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:450 Identity:92/450 - (20%)
Similarity:174/450 - (38%) Gaps:78/450 - (17%)


- Green bases have known domain annotations that are detailed below.


Yeast   142 DYEIS---VSWQIGLCLCYMAGEIVGLQMTGPSVDYMGNRYTLIM---------ALFFLA---AF 191
            |:|::   :||         .|.::||       |.:....|:.|         .|:.:|   |.
  Fly    53 DFEVNLAQISW---------LGSMLGL-------DSLCGNLTIAMLIERAGRKFCLYLMAGPYAC 101

Yeast   192 IFILYFCKS-LGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSNLCWAFGQLFAAG 255
            |:||.:|.| :..:...:.|||...|....:...:.||:....:|..||:...|....|.|  ||
  Fly   102 IWILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGIL--AG 164

Yeast   256 IMKNSQNKYANSELGYKLPFALQWIWPLPLAVGIFFAPESPWWLVKKGRIDQARRSLERTLSGKG 320
            .:.::...|      :.:|| |..|.|:...:.....||:..:|:||.::..|..|.....:.:.
  Fly   165 YILSTYLAY------HVVPF-LAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRS 222

Yeast   321 PEKELLVSMELDKIKTTIEKEQ-KMSDEGTYWDCVKDGINRRRTRIACLCWIGQCSCGASLIGYS 384
            ...|....:..::::|.:..:| :.:...:|.|.......:.......|....|.|...|.|.|.
  Fly   223 AICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYM 287

Yeast   385 TYFYEKAGVSTDTAFTFSIIQYCLGIAATFISWWASKYCGRFDLY---AFGLAFQAIMFFIIGGL 446
            :..::.:|...|.. |.:||...:.|...:.|.......||..|.   ..|:....|.|      
  Fly   288 SDIFKASGSVVDVN-TATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAF------ 345

Yeast   447 GC----------SDTHGAKMGSGALLMVVAFFYNLGIAPVVFCLVSEIPSSRLRT-----KTIIL 496
            ||          ||.:...:   .|::::.:..|:|:..:.|.::.|:...::|:     ..|.|
  Fly   346 GCFTYLAKIYDLSDFNWLPL---VLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSVIFL 407

Yeast   497 ARNAYNVIQVVVTVLIMYQLNSEKWNWGAKSGFFWGGFCLATLAWAVVDLPETAGRTFIE 556
            :...:..:::...:|..:.::...|        |.....|.|..:..:.|.||.|::.||
  Fly   408 SLLVFGTLKLFPLMLHYWGISFTMW--------FSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAL31NP_009857.1 SP 74..557 CDD:273317 91/449 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 86/437 (20%)
MFS_1 53..409 CDD:284993 81/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342484
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.