DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAS7 and Nedd4

DIOPT Version :9

Sequence 1:NP_958839.1 Gene:GAS7 / 8522 HGNCID:4169 Length:476 Species:Homo sapiens
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:456 Identity:82/456 - (17%)
Similarity:137/456 - (30%) Gaps:170/456 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    61 EKPGMVPP----PPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSH 121
            |....|||    ..|||..   |||.|...::|.||.::::..:..|||..|.:....|....:.
  Fly   512 EDNAAVPPMEQNTGGEEEP---LPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTR 573

Human   122 R--SSLPPTVNGY----HASG-----------TPAHPPETAHMS--------------------- 148
            |  ..|.|...|:    |..|           |....|..::.:                     
  Fly   574 RVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDYKQKYEYFKS 638

Human   149 -VRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLK------------------ 194
             :||.|        :.|:|.:.:....:|...::....::.:..|||                  
  Fly   639 HIRKPT--------NVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGL 695

Human   195 PTEWSYC-------------DYFWADKKDPQGN-----------------GTVAG---------- 219
            ..||.|.             :|...|....|.|                 |.:||          
  Fly   696 AREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLD 760

Human   220 -------FELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAK---LSQNSLA--SQEEGSLG 272
                   ::::|||.:..|.|:...:|:....:.|:|:..:.|..   |.::...  ||.|...|
  Fly   761 AFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDVFGQKSQHELKPG 825

Human   273 EAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKD-----MKKCDHHIADLRKQLASR 332
            .|...|.....|| .:.|....:..:.|::.:.:|.:.|...     :|..|.|           
  Fly   826 GANIDVTNENKDE-YIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEH----------- 878

Human   333 YASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKW 397
                                   :||:.:......|:|..|..:...||..|      |....:|
  Fly   879 -----------------------ELELLMCGIQNIDVKDWRENTLYKGDYHM------NHIIIQW 914

Human   398 F 398
            |
  Fly   915 F 915

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAS7NP_958839.1 SH3_GAS7 5..57 CDD:212763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..171 18/109 (17%)
WW_FCH_linker 109..201 CDD:374680 20/148 (14%)
F-BAR_GAS7 214..446 CDD:153333 40/229 (17%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 10/28 (36%)
WW 581..613 CDD:197736 6/31 (19%)
HECTc 650..1003 CDD:238033 50/307 (16%)
HECTc 674..1003 CDD:214523 49/283 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.