DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VBA4 and CG33282

DIOPT Version :9

Sequence 1:NP_010404.1 Gene:VBA4 / 851697 SGDID:S000002526 Length:768 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:421 Identity:78/421 - (18%)
Similarity:151/421 - (35%) Gaps:100/421 - (23%)


- Green bases have known domain annotations that are detailed below.


Yeast   283 LWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIF----- 342
            |.::|.:.|...|.:..|.|....|...:..|..|.:     :.|.|     |..|..|:     
  Fly    58 LAQISWLGSMLGLDSLCGNLTIAMLIERAGRKFCLYL-----MAGPY-----ACIWILIYCASNV 112

Yeast   343 -----ARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGS 402
                 ||.:.||.||:...:....::..:..|......|..|::..:|::.| ::::.:.:.|..
  Fly   113 YYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAG-YILSTYLAYHVV 176

Yeast   403 GWRNAFLIPVPFCLVNASIML---ADMYSVKSTLYGRPTPTLWKRFKNTLL----SPDLYEILTL 460
            .:. |.::||.:.:.|  |||   |.....||.|........:.|.:.:.:    |...:|.|..
  Fly   177 PFL-AIILPVAYFIAN--IMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRT 238

Yeast   461 TLFLLCFVQVTSLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIW 525
            .:........|.|....|.....::....|:::..|..|..:.:...||:.:...|         
  Fly   239 AVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKAS--------- 294

Yeast   526 TMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLL 590
                              |:   ::.:|.:|             |::|...:...:.|   ..|:
  Fly   295 ------------------GS---VVDVNTAT-------------IIIGLVQIVGVYTS---TILV 322

Yeast   591 KFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIV 655
            ..|  |..:|:.::.|||.:.        |::..      ..|.|:.:| :..:....|:...|:
  Fly   323 DIV--GRRVLMLISTMGVGIG--------CIAFG------CFTYLAKIY-DLSDFNWLPLVLMII 370

Yeast   656 YCFGAVGGTVGISLGGYVFHKTLIKLMHEKV 686
            .|:.|..|.:||      |...|::|...|:
  Fly   371 ICYVANIGLIGI------FFLVLVELFPVKI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VBA4NP_010404.1 MFS 259..>414 CDD:421695 29/140 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 78/421 (19%)
MFS_1 53..409 CDD:284993 78/421 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.