DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRK1 and par-1

DIOPT Version :9

Sequence 1:NP_010204.1 Gene:MRK1 / 851480 SGDID:S000002237 Length:501 Species:Saccharomyces cerevisiae
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:430 Identity:105/430 - (24%)
Similarity:166/430 - (38%) Gaps:118/430 - (27%)


- Green bases have known domain annotations that are detailed below.


Yeast    53 HHTVPNFNNSSEYINDIENLIISKLIDGGKEGIAVDHIEH------------ANISDSKTDGKVA 105
            ||...|.......::...:.:::        ..|::|..|            .|:..:.:....|
  Fly   163 HHVANNMTTDGARLSSNNSAVVA--------SSAINHHHHHTPGSGVAPTVNKNVLSTHSAHPSA 219

Yeast   106 NKHENISSKLSKEKVEKMINFDYRYIKTKERTIHKRVYKHDRKTDVDRKNHGGTIDISYPTTEVV 170
            .|....|:| ....::...:...|:..|:|                    |.|    .|...:.:
  Fly   220 IKQRTSSAK-GSPNMQMRSSAPMRWRATEE--------------------HIG----KYKLIKTI 259

Yeast   171 GHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKN--------RELETMKMLCHPNTVGLQYYFYEK 227
            |.|:|..|.....:.|.::||||.:  |:...|        ||:..||||.|||.|.|   |...
  Fly   260 GKGNFAKVKLAKHLPTGKEVAIKII--DKTQLNPGSLQKLFREVRIMKMLDHPNIVKL---FQVI 319

Yeast   228 DEEDEVYLNL-------VLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFKALNYLHNVPRI 285
            :.|..:||.:       |.||:          .::.:|:.....:||  .|:..|:.|.|. .||
  Fly   320 ETEKTLYLIMEYASGGEVFDYL----------VLHGRMKEKEARVKF--RQIVSAVQYCHQ-KRI 371

Yeast   286 CHRDIKPQNLLVDPTTFSFKICDFGSAKCLKPDQPNVSYICSRYYRAPELMFGATNYSNQVDVWS 350
            .|||:|.:|||:| :..:.||.|||.:....|.....::..|..|.||||..|......:|||||
  Fly   372 IHRDLKAENLLLD-SELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWS 435

Yeast   351 SACVIAELLLGKPLFSGESGIDQLVEII--------------------KIMGI-PTK----DEIS 390
            ...::..|:.|...|.| |.:.:|.|.:                    |.:.: |.|    :.|.
  Fly   436 LGVILYTLVSGSLPFDG-STLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIM 499

Yeast   391 G---MNPNY-EDHVFPNIKPITLAEIFKAE--DPDTLDLL 424
            |   ||..: ||.:.|.|:|       ||:  ||..::.|
  Fly   500 GDKWMNMGFEEDELKPYIEP-------KADLADPKRIEAL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRK1NP_010204.1 STKc_GSK3 159..449 CDD:271039 89/312 (29%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 77/271 (28%)
S_TKc 253..504 CDD:214567 77/270 (29%)
UBA_MARK_Par1 525..563 CDD:270522 3/8 (38%)
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.