DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNAB2 and CG18547

DIOPT Version :9

Sequence 1:XP_016858110.1 Gene:KCNAB2 / 8514 HGNCID:6229 Length:435 Species:Homo sapiens
Sequence 2:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster


Alignment Length:359 Identity:89/359 - (24%)
Similarity:154/359 - (42%) Gaps:72/359 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    90 MKYRNLGKSGLRVSCLGLGTWVTFGGQITD----EMAEQLMTL--AYDNGINLFDTAEVYAAGKA 148
            |:||||||:||:||.:..|     ||.:..    ::.|.:.|:  |..:|||..|||..|..|::
  Fly    22 MEYRNLGKTGLQVSKVSFG-----GGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGRS 81

Human   149 EVVLGNIIKKKGWRRSSLVITTKIFWGGKAETER----GLSRKHIIEGLKASLERLQLEYVDVVF 209
            |.|||  :..|...|.|..|.||:   .:.|.:.    ..|.|...|.::.||:.|.|:||||: 
  Fly    82 EEVLG--LALKDVPRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVI- 140

Human   210 ANRPDPNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAY--SVARQ 272
                      :......:|....:|.||:..:..::.:|.|.:.|.|         ||  ||.::
  Fly   141 ----------QIHDIEFAKDLDIVINETLPTLEQLVKEGKARFIGVS---------AYPISVLKE 186

Human   273 FNLT------PPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYS 331
            | ||      ..:...|.|.:  .::..::..:.|....:|.:..:..|.|:::   ::|..|:.
  Fly   187 F-LTRTAGRLDTVLTYARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLT---NAGPQPWH 245

Human   332 RASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRN-EGVSSVLLGASNA 395
            .||                ..|:|..::...:.:..|..|.:||:.:.:.. ..||:.|.|....
  Fly   246 PAS----------------DEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTR 294

Human   396 DQLMENIGAIQV-LPKLSSSIIHEIDSILGNKPY 428
            ..|..|:.|.:| |......::..:...:..||:
  Fly   295 QLLRINLDANEVGLSDKEQEVLRYLKENVLTKPF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNAB2XP_016858110.1 None
CG18547NP_650138.1 Tas 22..331 CDD:223739 89/359 (25%)
Aldo_ket_red 24..321 CDD:294321 86/348 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.