DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDH2 and Spf45

DIOPT Version :9

Sequence 1:NP_010066.1 Gene:GDH2 / 851311 SGDID:S000002374 Length:1092 Species:Saccharomyces cerevisiae
Sequence 2:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster


Alignment Length:91 Identity:23/91 - (25%)
Similarity:35/91 - (38%) Gaps:34/91 - (37%)


- Green bases have known domain annotations that are detailed below.


Yeast   593 DIYDLNSKNVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGLVEHDQTFVAFSQYVDAMIDILI 657
            |:||     .||       |:.|.::  .:|.|.|:.:|        ||.:|        :.:.:
  Fly     2 DLYD-----GID-------TRARSSQ--IDGWSSGIKML--------QTQLA--------VKMAV 36

Yeast   658 NDPLKENYVNLLPKE----EILFFGP 679
            ..||....|||..|.    |:..|.|
  Fly    37 KKPLMTPVVNLRSKRLADPEVTCFAP 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDH2NP_010066.1 Bac_GDH 1..1092 CDD:421780 23/91 (25%)
Spf45NP_001036426.1 G-patch 209..248 CDD:279867
RRM_UHM_SPF45 307..402 CDD:241091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.