DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PML1 and CG17168

DIOPT Version :9

Sequence 1:NP_013116.1 Gene:PML1 / 850703 SGDID:S000004006 Length:204 Species:Saccharomyces cerevisiae
Sequence 2:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster


Alignment Length:243 Identity:61/243 - (25%)
Similarity:91/243 - (37%) Gaps:89/243 - (36%)


- Green bases have known domain annotations that are detailed below.


Yeast     4 RRKRPYNTRNYGHDDKKFKSQYID-------------IMPDFSPSGLLELESNNKEGIALKHVEP 55
            :|.:.:|..|...||.....:.:|             ..|:|..||.|..::|...|:.:|:.||
  Fly   207 QRNQRHNNSNKNEDDHYVWGKEVDEKVPAENDVPVDKEKPNFGLSGALTEDTNKLNGVVVKYSEP 271

Yeast    56 QDAISPDNYMDMLGLEARDRTMYELVIYRKNDKDKGPWKRYDLNG-----------RSCYLVGRE 109
            .:|..|                            |..|:.|...|           :||:|||| 
  Fly   272 PEARKP----------------------------KRRWRLYPFKGETALPTLHIHRQSCFLVGR- 307

Yeast   110 LGHSLDTDLDDRTEIVVADIGIPEETSSKQHCVIQFRNV--------RG-ILKCYVMDLDSSNGT 165
                      ||.   |.|:.:...:.||||..:|:|.|        .| .::.|::||||:|||
  Fly   308 ----------DRK---VVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGT 359

Yeast   166 CLNNVVIPGARYIELRSGDVLTL--------------SEFEEDNDYEL 199
            .|||..|...:|.||...||:..              .|.:||:|..:
  Fly   360 FLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHENSKEDQEDDDVHI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PML1NP_013116.1 FHA 85..192 CDD:238017 40/140 (29%)
CG17168NP_001015254.1 FHA 280..395 CDD:238017 38/128 (30%)
FHA <294..411 CDD:224630 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344073
Domainoid 1 1.000 47 1.000 Domainoid score I3055
eggNOG 1 0.900 - - E1_KOG1882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004489
OrthoInspector 1 1.000 - - oto99860
orthoMCL 1 0.900 - - OOG6_102703
Panther 1 1.100 - - LDO PTHR23308
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2234
SonicParanoid 1 1.000 - - X4267
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.