DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VBA3 and CG33282

DIOPT Version :9

Sequence 1:NP_009864.1 Gene:VBA3 / 850290 SGDID:S000000574 Length:458 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:443 Identity:80/443 - (18%)
Similarity:149/443 - (33%) Gaps:179/443 - (40%)


- Green bases have known domain annotations that are detailed below.


Yeast    17 GLQTLCFVIGCTMVGERS-RPLVISILS-------------------------CAFAVAA--IVG 53
            ||.:||..:...|:.||: |...:.:::                         |.|...|  :|.
  Fly    69 GLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVV 133

Yeast    54 PI---------IGGAFTT-------------HVTWRWCFYINLPIGGLAIIMFLLTYKA-----E 91
            ||         |.||.|:             ::...:..|..:|.  ||||:.:..:.|     |
  Fly   134 PIFISEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPF--LAIILPVAYFIANIMLPE 196

Yeast    92 NKGILQQIKDAIGTISSFTFSKFRHQ----------VNFKRLMNGII----------------FK 130
            ....|.:........:||.:  :|:|          |||:.|...::                .|
  Fly   197 TAPYLLKKSQLAAAENSFRY--YRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTK 259

Yeast   131 FDFFGFALCSAGLVLFLLGLTFGGNKYSW---------NSGQVI----AYLVLGVLLFIFSLVYD 182
            ....|||   |.:|| .||..|.| .:|:         .||.|:    |.:::|::..:.     
  Fly   260 PALKGFA---ASIVL-SLGYQFSG-VFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVG----- 314

Yeast   183 FFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIIN-MVTFLLCTGYNGQMIYSVQFFQLIFASSAW 246
                          .|...:|..:|.:..:::|: |...:.|..: |...|..:.:.|       
  Fly   315 --------------VYTSTILVDIVGRRVLMLISTMGVGIGCIAF-GCFTYLAKIYDL------- 357

Yeast   247 KAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTK----STQI 307
             :..:.:|:|:..:|..:|:                   :|:||...:.|:.....|    :|.:
  Fly   358 -SDFNWLPLVLMIIICYVAN-------------------IGLIGIFFLVLVELFPVKIRSLATSL 402

Yeast   308 GVLLLP-------------------GFSLGFALQASLMS-----AQLQITKDR 336
            .|:.|.                   .|::.|:..::|::     ..||.||.:
  Fly   403 SVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VBA3NP_009864.1 MFS <1..369 CDD:421695 80/443 (18%)
MFS <1..>181 CDD:421695 52/257 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 76/434 (18%)
MFS_1 53..409 CDD:284993 73/395 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.