DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RERG and Rerg

DIOPT Version :9

Sequence 1:NP_116307.1 Gene:RERG / 85004 HGNCID:15980 Length:199 Species:Homo sapiens
Sequence 2:NP_001157684.1 Gene:Rerg / 232441 MGIID:2665139 Length:199 Species:Mus musculus


Alignment Length:199 Identity:196/199 - (98%)
Similarity:199/199 - (100%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQE 65
            |||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MAKSAEVKLAIFGRAGVGKSAIVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQE 65

Human    66 DTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVST 130
            |||||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||
Mouse    66 DTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEVKKPKNVTLILVGNKADLDHSRQVST 130

Human   131 EEGEKLATELACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLT 195
            ||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||
Mouse   131 EEGEKLATELACAFYECSACTGEGNITEVFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLT 195

Human   196 KISS 199
            ||||
Mouse   196 KISS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RERGNP_116307.1 RERG_RasL11_like 8..169 CDD:206713 157/160 (98%)
RergNP_001157684.1 RERG_RasL11_like 8..169 CDD:206713 157/160 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83963273
Domainoid 1 1.000 325 1.000 Domainoid score I14753
eggNOG 1 0.900 - - E2759_KOG0395
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H50026
Inparanoid 1 1.050 395 1.000 Inparanoid score I13761
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG50142
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0009184
OrthoInspector 1 1.000 - - oto123360
orthoMCL 1 0.900 - - OOG6_114004
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5611
SonicParanoid 1 1.000 - - X6920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1818.300

Return to query results.
Submit another query.