DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF21 and hbs

DIOPT Version :9

Sequence 1:NP_116269.3 Gene:IGSF21 / 84966 HGNCID:28246 Length:467 Species:Homo sapiens
Sequence 2:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster


Alignment Length:544 Identity:122/544 - (22%)
Similarity:186/544 - (34%) Gaps:176/544 - (32%)


- Green bases have known domain annotations that are detailed below.


Human     4 APSLRRCVCLLLAAILDLARGYLTVNIEPLP-------------------PVVAGDAVTLKCNFK 49
            |..|...:|.::||:           ..|.|                   .::.|....|:|  :
  Fly    10 AVHLATTICHVMAAV-----------TAPTPAAQVAAPPVQKFHLTPHDLQILEGTDTLLRC--E 61

Human    50 TDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNYSHMENYRKREDLVYQS-TVRLPEVRISDNGP 113
            ...|..::.|.:  ||         |...||........|....|....: .:::....:.|:..
  Fly    62 VSNRAGKVQWTK--DG---------FALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAE 115

Human   114 YECHVGIYDRATREKVVLASGNIFLNVMAPPTSIEVVAADTPAPFSRYQAQNFTLVCIVSGGKP- 177
            |:|.||   .|.....:.|  |..|:::|.|:||.:......|.....:.||.||.||.....| 
  Fly   116 YQCQVG---PAAGNPAIRA--NAKLSIVAAPSSIVIEGYARNARVEVEERQNLTLHCIAENANPA 175

Human   178 APMVYFKRDGEPIDAVPLSEPPAASSGPLQDSRPFR----SLLH---RDLDDTK----------- 224
            |.:|:|:  ||    ||:|..|..:   :..:.|.|    |.||   |..||.|           
  Fly   176 AEIVWFQ--GE----VPVSTAPIVT---VNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKAL 231

Human   225 -------MQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHSAE 282
                   .|..||:|...   |.|:.|..|:|.|                          :|..:
  Fly   232 PPDVPMRAQVQLSVLYPP---GAPFFEGYSQGET--------------------------LHRGQ 267

Human   283 PTYFLRHSRTPSSDGTVEVRALLTWTLN------PQ-----------------IDNEALFSCEVK 324
            .......||..:..      |.|||..|      ||                 .||.|...||.|
  Fly   268 EVQIACRSRGGNPP------AQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAK 326

Human   325 HPALSMPMQAEVTLVAPKGPKIVMT--PSRARVGDTVRI-LVHGFQNEVFPEPMFTWTRVGSRLL 386
            :...:.|::||:.|.....||.|..  .::|:|||:|:: .|....|   |:...:|: :..|.|
  Fly   327 NLLATTPLRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSN---PQARISWS-INGRPL 387

Human   387 DGSA-------------------EFDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFE 432
            |.|.                   ..|.:......|...||..:    .||.:||   ||..:::.
  Fly   388 DNSTYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALNTEL----TQNVVGS---HTVNVLYP 445

Human   433 NPNIPRGTEDSNGSIGPTGARLTL 456
             |:.|..|..::|.|..:|:.|.|
  Fly   446 -PSPPLLTGYNDGDILISGSILKL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF21NP_116269.3 IG_like 36..140 CDD:214653 21/104 (20%)
Ig 39..130 CDD:299845 18/91 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..259 9/29 (31%)
IG_like 353..430 CDD:214653 23/96 (24%)
Ig 369..432 CDD:299845 16/81 (20%)
hbsNP_001286439.1 Ig 44..122 CDD:299845 17/93 (18%)
IG_like 45..137 CDD:214653 21/109 (19%)
Ig 153..231 CDD:299845 26/86 (30%)
IG_like 258..342 CDD:214653 23/115 (20%)
Ig 266..327 CDD:299845 14/66 (21%)
IG_like 357..>414 CDD:214653 13/60 (22%)
Ig 360..427 CDD:299845 13/70 (19%)
Ig <468..526 CDD:299845 1/1 (100%)
I-set 547..633 CDD:254352
Ig 556..631 CDD:299845
I-set 644..735 CDD:254352
IGc2 668..725 CDD:197706
IG_like 751..829 CDD:214653
IGc2 753..815 CDD:197706
Ig 852..928 CDD:143165
FN3 935..1017 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.