DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB2B and VPS21

DIOPT Version :9

Sequence 1:NP_116235.2 Gene:RAB2B / 84932 HGNCID:20246 Length:216 Species:Homo sapiens
Sequence 2:NP_014732.1 Gene:VPS21 / 854256 SGDID:S000005615 Length:210 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:77/216 - (35%)
Similarity:120/216 - (55%) Gaps:24/216 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSIT 72
            |.:::|:..||||.::|:|....|....:.|||..|..:.|.|:...:|.:||||||||.|.|:.
Yeast     9 KLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLA 73

Human    73 RSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDL---ESRRDVKREEG 134
            ..|||.|..||:|||:|:.::|.....|:::..:.:|.:::|.|:|||.|:   ...|.|.||||
Yeast    74 PMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEG 138

Human   135 EAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGP 199
            |..|.|.||:|.||||||..||.:.|:...::|                .:|...:|:.:::...
Yeast   139 EKLAEEKGLLFFETSAKTGENVNDVFLGIGEKI----------------PLKTAEEQNSASNERE 187

Human   200 SASQR---NSRDIG--SNSGC 215
            |.:||   |:.:.|  :||.|
Yeast   188 SNNQRVDLNAANDGTSANSAC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB2BNP_116235.2 PLN03108 1..216 CDD:178655 77/216 (36%)
Effector region. /evidence=ECO:0000250 35..43 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..216 9/32 (28%)
VPS21NP_014732.1 Rab5_related 7..172 CDD:206653 67/178 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.