DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB2B and Rab2b

DIOPT Version :9

Sequence 1:NP_116235.2 Gene:RAB2B / 84932 HGNCID:20246 Length:216 Species:Homo sapiens
Sequence 2:NP_001032734.1 Gene:Rab2b / 305853 RGDID:1309117 Length:215 Species:Rattus norvegicus


Alignment Length:216 Identity:206/216 - (95%)
Similarity:210/216 - (97%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQ 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQ 65

Human    66 ESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVK 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 ESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVK 130

Human   131 REEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSIST 195
            |||||||||||||||||||||||||||||:|||||||:||||||||||||||||||||||||||.
  Rat   131 REEGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIHRKIQQGLFDVHNEANGIKIGPQQSISL 195

Human   196 SVGPSASQRNSRDIGSNSGCC 216
             |||..||:||.|||.:||||
  Rat   196 -VGPCPSQQNSSDIGPDSGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB2BNP_116235.2 PLN03108 1..216 CDD:178655 204/214 (95%)
Effector region. /evidence=ECO:0000250 35..43 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..216 18/26 (69%)
Rab2bNP_001032734.1 PLN03108 1..215 CDD:178655 204/214 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83682997
Domainoid 1 1.000 320 1.000 Domainoid score I14352
eggNOG 1 0.900 - - E2759_KOG0098
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23789
Inparanoid 1 1.050 411 1.000 Inparanoid score I13061
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 1 1.000 - - oto141132
orthoMCL 1 0.900 - - OOG6_101535
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1717.270

Return to query results.
Submit another query.