DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATOH8 and CG33557

DIOPT Version :9

Sequence 1:XP_011531441.1 Gene:ATOH8 / 84913 HGNCID:24126 Length:328 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:145 Identity:39/145 - (26%)
Similarity:63/145 - (43%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   190 SSYSSISHVIYNNHQDSSASPRKRPGEATAASSEIKALQQTR----------------RLLANAR 238
            ||:|:....::....:||.|   ..|...||.||...:.|..                |...|||
  Fly     8 SSFSNYLMAVFAQDSNSSGS---ASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINAR 69

Human   239 ERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFSECV 303
            ||.|...:::|:||||..:|.....:||||:.|:|:|.:||..|:...:          :.:||.
  Fly    70 ERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLE----------TGTECQ 124

Human   304 QRCTRTLQAEGRAKK 318
            .......::||..::
  Fly   125 PCLLHKYESEGITRR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATOH8XP_011531441.1 HLH 231..282 CDD:278439 22/66 (33%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.