DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP4K3 and Pak3

DIOPT Version :9

Sequence 1:NP_003609.2 Gene:MAP4K3 / 8491 HGNCID:6865 Length:894 Species:Homo sapiens
Sequence 2:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster


Alignment Length:265 Identity:105/265 - (39%)
Similarity:154/265 - (58%) Gaps:9/265 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    11 NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVA 75
            :|:|.::..|.:|.|..|.|:.|.::......|:|.|.::......::..||.::||..|.|:|.
  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVN 352

Human    76 YFGSYL--RRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIK 138
            :..:||  ..|:||:.||:..||.|.|:...| .:.|.|||.|.||||..:.:||:||.:|||||
  Fly   353 FLDAYLLEPEDQLWVVMEYMDGGPLTDVVTET-VMKERQIACVCRETLYAISFLHAKGIIHRDIK 416

Human   139 GANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGIT 203
            ..|:||..:|.||:.|||..|.|... .||::.:||||||||||  |.|| .|.:..|:|::||.
  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEV--VTRK-KYGKKVDIWSIGIM 477

Human   204 AIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLL 268
            |||:.|.|||.....|:|||:|:..:.  .|.:|...|.|.:...|:...|.....:|.||::||
  Fly   478 AIEMIEGQPPYLYETPLRALYLIAANG--RPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELL 540

Human   269 QHPFV 273
            .|||:
  Fly   541 SHPFL 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP4K3NP_003609.2 STKc_MAP4K3_like 15..273 CDD:270788 102/259 (39%)
S_TKc 16..273 CDD:214567 102/258 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..536
CNH 561..874 CDD:214481
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 104/263 (40%)
S_TKc 293..545 CDD:214567 102/258 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.