DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZSCAN10 and ehn-3

DIOPT Version :9

Sequence 1:	NP_116194.2	Gene:	ZSCAN10 / 84891	HGNCID:	12997	Length:	780	Species:	Homo sapiens
Sequence 2:	NP_001023615.1	Gene:	ehn-3 / 191363	WormBaseID:	WBGene00001223	Length:	262	Species:	Caenorhabditis elegans

Alignment Length:	123	Identity:	39/123 - (31%)
Similarity:	59/123 - (47%)	Gaps:	11/123 - (8%)

- Green bases have known domain annotations that are detailed below.

Human   664 CDTCGHRFRNSSNLARHRRSHTGERPYSCQTCGRSFRRNAHLRRHLATHAEPGQEQAEPPQEC-- 726
            ||.|..:|.|.:||.||:..|:|::.:.||.|.|.|.||..::.|:.||.:.|.     ..||
Worm     4 CDICHQKFSNKTNLNRHKVMHSGKKKFECQFCRRPFFRNDRMKEHMMTHIKKGN-----TFECPI 63

Human   727 VECGKSFSRSCNLLRHL---LVHTGARPYSCTQCGRSFSRNSHLLRHLRT-HARETLY 780
            ..|...|:...:|..|:   .:..|:.|..|..|.:.|:.:..||.|..| |...|.:
Worm    64 TACNSKFNSFTSLQFHVDSEHIIRGSSPAKCKSCIKWFNSSHRLLLHFHTAHLDHTKF 121

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZSCAN10	NP_116194.2	SCAN	40..124	CDD:153421
		PHA03418	156..>314	CDD:177646
		C2H2 Zn finger	349..370	CDD:275368
		C2H2 Zn finger	378..398	CDD:275368
		zf-H2C2_2	391..415	CDD:290200
		COG5048	400..774	CDD:227381	37/115 (32%)
		C2H2 Zn finger	406..426	CDD:275368
		C2H2 Zn finger	434..454	CDD:275368
		C2H2 Zn finger	478..498	CDD:275368
		zf-C2H2	522..544	CDD:278523
		C2H2 Zn finger	524..544	CDD:275368
		zf-H2C2_2	536..561	CDD:290200
		C2H2 Zn finger	552..572	CDD:275368
		zf-H2C2_2	565..589	CDD:290200
		C2H2 Zn finger	580..600	CDD:275368
		zf-H2C2_2	592..615	CDD:290200
		C2H2 Zn finger	608..628	CDD:275368
		zf-H2C2_2	620..645	CDD:290200
		C2H2 Zn finger	636..656	CDD:275368
		zf-H2C2_2	648..673	CDD:290200	4/8 (50%)
		C2H2 Zn finger	664..684	CDD:275368	9/19 (47%)
		zf-H2C2_2	676..701	CDD:290200	11/24 (46%)
		C2H2 Zn finger	692..712	CDD:275368	8/19 (42%)
		C2H2 Zn finger	728..746	CDD:275368	4/20 (20%)
		zf-H2C2_2	738..763	CDD:290200	7/27 (26%)
		zf-C2H2	752..774	CDD:278523	7/22 (32%)
		C2H2 Zn finger	754..774	CDD:275368	7/20 (35%)
ehn-3	NP_001023615.1	C2H2 Zn finger	4..24	CDD:275368	9/19 (47%)
		C2H2 Zn finger	32..52	CDD:275368	8/19 (42%)
		C2H2 Zn finger	61..80	CDD:275368	4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910