DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TMEM25 and ttc-36

DIOPT Version :9

Sequence 1:	XP_005271760.1	Gene:	TMEM25 / 84866	HGNCID:	25890	Length:	382	Species:	Homo sapiens
Sequence 2:	NP_496168.1	Gene:	ttc-36 / 174562	WormBaseID:	WBGene00009947	Length:	179	Species:	Caenorhabditis elegans

Alignment Length:	105	Identity:	25/105 - (23%)
Similarity:	44/105 - (41%)	Gaps:	32/105 - (30%)

- Green bases have known domain annotations that are detailed below.

Human   201 SLAHNLSV--------VATNDVGVT-----SASLPAPGL-LATRVEVPLLGIVVAAGLALGTLVG 251
            |.:|:.:|        :.|:|.|:.     |.||..||. |:.::|..  |:.:|.|:.|...:
Worm     2 STSHDRAVLNQILNPLMPTSDSGIAEIHLESDSLEHPGYELSLQLERE--GVALAEGVRLDEAI- 63

Human   252 FSTLVACLVCRKEKKTKGPS---RHPSLISSDSNNLKLNN 288
                        ||.||...   ::||..::.:...:|.|
Worm    64 ------------EKFTKALEVCPKNPSAYNNRAQAYRLQN 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TMEM25	XP_005271760.1	Ig	27..118	CDD:299845
ttc-36	NP_496168.1	TPR_11	43..107	CDD:290150	13/64 (20%)
		TPR repeat	46..71	CDD:276809	9/39 (23%)
		TPR_11	76..144	CDD:290150	4/16 (25%)
		TPR repeat	76..106	CDD:276809	4/16 (25%)
		TPR_1	77..106	CDD:278916	4/15 (27%)
		TPR repeat	115..143	CDD:276809
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4555
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900