DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMEM25 and tmem25

DIOPT Version :9

Sequence 1:XP_005271760.1 Gene:TMEM25 / 84866 HGNCID:25890 Length:382 Species:Homo sapiens
Sequence 2:XP_031760734.1 Gene:tmem25 / 100170615 XenbaseID:XB-GENE-22069321 Length:308 Species:Xenopus tropicalis


Alignment Length:308 Identity:107/308 - (34%)
Similarity:158/308 - (51%) Gaps:55/308 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    10 LRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEA 74
            ||.:||....|...|.||             .|:::|....:|. .|||.   |:||::|..||.
 Frog     3 LRVSLLFFQPLFQRGLGE-------------PLQKDETEGASCE-GGGPS---LSWYMNGVKQEE 50

Human    75 STSR----LLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQV 135
            ...|    ||.|    :.|.:|..|:...|.:   ||      |........:|:|.|.|:    
 Frog    51 GLGREPPFLLPV----YPGSSSVLTLVETRGE---NC------SDAWLKGEELLSVHFPPD---- 98

Human   136 GAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLR 200
             :....|..||:.::|..:||..|.:..|..|.||..|:|:|..|:||.:|..  ||.:::::  
 Frog    99 -SPVNSAHTPGISLLLLLVVRTQPASTFTLRDHDGRKTLNSSRLLLLDTRNLD--TNGSLRVK-- 158

Human   201 SLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIVV-AAGLALGTLVGFSTLVACLVCRKE 264
                    |:|.:.||:..|:.|.|||::.|||||..:|| .||:..|.|: .:.||.||:.:::
 Frog   159 --------VSTEERGVSHTSVSALGLLSSHVEVPLFALVVGGAGVVAGILL-VNALVCCLLLKRK 214

Human   265 KKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSR 312
            :::.|.....:|  |.|||:||||..||||:||||||||||||.|.:|
 Frog   215 RRSYGVRNQLTL--STSNNMKLNNSCLPREHMSLPSNLQLNDLRPQAR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMEM25XP_005271760.1 Ig 27..118 CDD:299845 24/94 (26%)
tmem25XP_031760734.1 BiPBP_C <33..77 CDD:399665 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I21388
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12403
Inparanoid 1 1.050 157 1.000 Inparanoid score I12564
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D202896at32523
OrthoFinder 1 1.000 - - FOG0012148
OrthoInspector 1 1.000 - - oto159132
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10041
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.