DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GALR3 and AstA-R2

DIOPT Version :9

Sequence 1:NP_003605.1 Gene:GALR3 / 8484 HGNCID:4134 Length:368 Species:Homo sapiens
Sequence 2:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster


Alignment Length:299 Identity:97/299 - (32%)
Similarity:149/299 - (49%) Gaps:21/299 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    24 FALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLFILNLAVADLCFILCCVPFQATIYTLDAW 88
            |.:|.:.|..||.||:.|::..     ....|||:|.|:|||.|||.|::.|:||.||.|.:..|
  Fly    45 FGVIAITGFFGNLLVILVVVFN-----NNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYW 104

Human    89 LFGALVCKAVHLLIYLTMYASSFTLAAVSVDRYLAVRHPLRSRALRTPRNARAAVGLVWLLAALF 153
            .:|...|::|..||.:|.:||.:||..:|:||:|||.||:|||.:||......|:..:|::..:.
  Fly   105 PYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVV 169

Human   154 SAPYLSYYGTV---------RYGALELCVPAWED-ARRRALDVATFAAGYLLPVAVVSLAYGRTL 208
            |.|....:..|         .||   :|.....| ...|...|..|.:.||||:.::|..|.|.:
  Fly   170 SVPVAFTHDVVVDYDAKKNITYG---MCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMI 231

Human   209 RFLWAAVGPAGAAAAEARRRATGRAGRAMLAVAALYALCWGPHHALILCFWYGRFAFSPAT-YAC 272
            ..||..  ..|...::..:|...|..|.::.|...:|..|.|...::|.........:..| ...
  Fly   232 MRLWRQ--GTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVI 294

Human   273 RLASHCLAYANSCLNPLVYALASRHFRARFRRLWPCGRR 311
            ::.:..|||::||:|||:||..|.:||..|.:...|..|
  Fly   295 QVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GALR3NP_003605.1 7tm_4 24..>162 CDD:304433 54/137 (39%)
7tm_1 34..291 CDD:278431 86/267 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..368
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 50/121 (41%)
7tm_1 55..313 CDD:278431 86/267 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3617
eggNOG 1 0.900 - - E33208_3B9CW
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm9822
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1132
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.