DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRLA and si:cabz01036006.1

DIOPT Version :9

Sequence 1:NP_001171795.2 Gene:FCRLA / 84824 HGNCID:18504 Length:365 Species:Homo sapiens
Sequence 2:XP_021333347.1 Gene:si:cabz01036006.1 / 563900 ZFINID:ZDB-GENE-160113-146 Length:624 Species:Danio rerio


Alignment Length:280 Identity:76/280 - (27%)
Similarity:108/280 - (38%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    38 TLQCEGPVCTEE---SSCHTEDDLTD-AREAGFQVKAYTFS-----------------EPFHLIV 81
            ||.||.|..:..   |.....|.|:| :|.||   .:||.|                 ||     
Zfish   175 TLICEVPGSSTGWTFSWFRDADHLSDSSRGAG---GSYTLSPAALQHTGVYTCRAERGEP----- 231

Human    82 SYD---------W---------LILQGPAKPVFEGDLLVLRCQAWQDWPLTQVTFYRDGSALGPP 128
            :|.         |         |:|.......|..|.|.|.|.: ..|.:.:.|...........
Zfish   232 AYSSQNSSAQPLWVTGVSASVRLVLNASRSQHFSSDSLSLSCDS-AGWTVRRYTHTNTQDCSAQT 295

Human   129 GPNREFSITVVQKADSGHYHC---SGIFQSPGPGIPETASVVAITVQELFPAPILRAVPSAEPQ- 189
            |...|  |..:..:|:|.|.|   ||..:.|          :.|||.:   .|::.| .||:|. 
Zfish   296 GSTCE--IQSLSTSDTGVYWCESESGEKRHP----------LNITVHD---GPVILA-SSADPVI 344

Human   190 AGSPMTLSCQTKLPLQRS--AARLLFSFYKDGRIVQSRGLSSEFQIPTASEDHSGSYWCEAATED 252
            .|..:||.|     |.||  ::.|...|||||.::|:: .:.|..|||.|:...|.|:|:  ||.
Zfish   345 EGETLTLHC-----LHRSTISSILTADFYKDGLLIQNQ-TTGEMSIPTVSKSDEGFYYCK--TES 401

Human   253 NQVWKQSPQLEIRVQGASSS 272
                .:||...|.|:.:|.|
Zfish   402 ----IESPHSWISVRASSPS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRLANP_001171795.2 Ig 85..152 CDD:353325 18/78 (23%)
Ig_2 177..266 CDD:316418 32/91 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..319 3/8 (38%)
si:cabz01036006.1XP_021333347.1 Ig_2 43..151 CDD:316418
Ig_3 160..227 CDD:316449 15/54 (28%)
Ig 335..>397 CDD:325142 25/68 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277104at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9806
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.