Sequence 1: | NP_001171795.2 | Gene: | FCRLA / 84824 | HGNCID: | 18504 | Length: | 365 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261019.1 | Gene: | Strn-Mlck / 36753 | FlyBaseID: | FBgn0265045 | Length: | 8255 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 52/204 - (25%) |
---|---|---|---|
Similarity: | 77/204 - (37%) | Gaps: | 51/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 74 SEPFHLIVSYDWLILQGPAKPVFEGDLLVLRCQA------------WQDWPLTQVTFYRDGSALG 126
Human 127 PPGPNREFSITVVQKADSGHYHCSGIFQSPGPGIPETASVVAITVQELFPAPILRAVP-SAEPQA 190
Human 191 GSPMTLSCQTKLPLQRSAARLLFSFYKDG--------RI-VQSRGLSSEFQIPTASEDHSGSYWC 246
Human 247 EAATEDNQV 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FCRLA | NP_001171795.2 | Ig | 85..152 | CDD:353325 | 16/78 (21%) |
Ig_2 | 177..266 | CDD:316418 | 26/89 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 265..319 | ||||
Strn-Mlck | NP_001261019.1 | IG_like | 51..127 | CDD:214653 | |
Ig | <69..>112 | CDD:299845 | |||
I-set | 137..226 | CDD:254352 | |||
I-set | 235..314 | CDD:254352 | |||
Ig_2 | 244..314 | CDD:290606 | |||
I-set | 438..513 | CDD:254352 | |||
Ig | 454..510 | CDD:143165 | |||
I-set | 537..626 | CDD:254352 | |||
Ig | 555..618 | CDD:299845 | |||
I-set | 636..713 | CDD:254352 | |||
Ig | 652..712 | CDD:143165 | |||
SMC_N | <2190..2854 | CDD:280601 | |||
I-set | 5300..5388 | CDD:254352 | |||
IGc2 | 5313..5378 | CDD:197706 | |||
IG | 5412..5482 | CDD:214652 | |||
IGc2 | 5413..5481 | CDD:197706 | |||
I-set | 5542..5627 | CDD:254352 | |||
Ig | 5556..5621 | CDD:143165 | |||
Ig | 5654..5721 | CDD:143165 | |||
I-set | 5784..5874 | CDD:254352 | |||
IGc2 | 5797..5864 | CDD:197706 | |||
I-set | 5887..5970 | CDD:254352 | |||
Ig | 5902..5966 | CDD:143165 | |||
I-set | 5997..6086 | CDD:254352 | |||
Ig | 6026..6083 | CDD:143165 | |||
I-set | 6097..6187 | CDD:254352 | |||
Ig | 6114..6187 | CDD:299845 | |||
FN3 | 6216..6310 | CDD:238020 | 23/102 (23%) | ||
I-set | 6321..6412 | CDD:254352 | 27/90 (30%) | ||
Ig | 6328..6412 | CDD:299845 | 26/82 (32%) | ||
I-set | 6442..6531 | CDD:254352 | |||
Ig | 6459..6528 | CDD:143165 | |||
I-set | 6541..6632 | CDD:254352 | |||
IGc2 | 6555..6622 | CDD:197706 | |||
I-set | 6662..6754 | CDD:254352 | |||
Ig | 6679..6751 | CDD:143165 | |||
I-set | 6779..6868 | CDD:254352 | |||
IGc2 | 6793..6858 | CDD:197706 | |||
Ig | 6938..7022 | CDD:299845 | |||
I-set | 6939..7028 | CDD:254352 | |||
IG | 7075..7140 | CDD:214652 | |||
Ig | 7075..7140 | CDD:143165 | |||
IG | 7167..7239 | CDD:214652 | |||
Ig | 7173..7239 | CDD:143165 | |||
Ig | 7392..7475 | CDD:299845 | |||
IG | 7406..7475 | CDD:214652 | |||
FN3 | 7489..7588 | CDD:238020 | |||
S_TKc | 7620..7876 | CDD:214567 | |||
STKc_MLCK | 7626..7876 | CDD:271005 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |