| Sequence 1: | NP_001171795.2 | Gene: | FCRLA / 84824 | HGNCID: | 18504 | Length: | 365 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245581.1 | Gene: | Nrg / 31792 | FlyBaseID: | FBgn0264975 | Length: | 1309 | Species: | Drosophila melanogaster |
| Alignment Length: | 260 | Identity: | 59/260 - (22%) |
|---|---|---|---|
| Similarity: | 96/260 - (36%) | Gaps: | 69/260 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Human 97 EGDLLVLRCQAWQDWPLTQVTFY----RDGS---------ALGPPGPNREFSITVVQKADSGHYH 148
Human 149 -CS--GIFQSP---GPGIPETASVVAITVQELFPAPILRAVPSAEPQA--GSPMTLSC---QTKL 202
Human 203 PLQRSAARLLFSFYKDGRIVQ-----SRG-LSSEFQIPTASEDHSGSYWCEAATEDNQVWKQSPQ 261
Human 262 LEIRVQGASSSAAPPTLNPAPQKSAAP--GTAPEEAPGPLPPPPTPSSEDPGFS-SPLGMPDPHL 323
Human 324 323 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FCRLA | NP_001171795.2 | Ig | 85..152 | CDD:353325 | 21/70 (30%) |
| Ig_2 | 177..266 | CDD:316418 | 21/99 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 265..319 | 12/56 (21%) | |||
| Nrg | NP_001245581.1 | Ig | 55..128 | CDD:299845 | |
| IG_like | 57..127 | CDD:214653 | |||
| Ig | 135..214 | CDD:299845 | 20/67 (30%) | ||
| IG_like | 141..216 | CDD:214653 | 21/69 (30%) | ||
| ig | 251..332 | CDD:278476 | 23/102 (23%) | ||
| I-set | 339..427 | CDD:254352 | 10/45 (22%) | ||
| Ig | 354..427 | CDD:299845 | 5/17 (29%) | ||
| I-set | 432..517 | CDD:254352 | |||
| Ig | 446..517 | CDD:299845 | |||
| I-set | 522..611 | CDD:254352 | |||
| ig | 525..609 | CDD:278476 | |||
| FN3 | 613..707 | CDD:238020 | |||
| FN3 | 716..807 | CDD:238020 | |||
| fn3 | 817..905 | CDD:278470 | |||
| FN3 | 917..1004 | CDD:238020 | |||
| FN3 | 1041..1111 | CDD:238020 | |||
| Bravo_FIGEY | 1155..>1221 | CDD:290593 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||