DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRLA and si:ch211-165f21.7

DIOPT Version :9

Sequence 1:NP_001171795.2 Gene:FCRLA / 84824 HGNCID:18504 Length:365 Species:Homo sapiens
Sequence 2:XP_021333783.1 Gene:si:ch211-165f21.7 / 100320788 ZFINID:ZDB-GENE-070912-139 Length:386 Species:Danio rerio


Alignment Length:300 Identity:65/300 - (21%)
Similarity:106/300 - (35%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    19 LWVAQMLLAAGCHAAA-SFETLQCEGPVCTEESSCHTEDDLTDAREAGFQVKAYTFSEPFHLIVS 82
            |..||...||.|..|| ...|.:.|. :...:........|.::...  ::::.|..:|      
Zfish     3 LQYAQGQFAAKCDTAAIRISTTKSEA-IALHQRKWFATSRLEESPHP--KLRSSTRPKP------ 58

Human    83 YDWLILQGPAKPVFEGDLLVLRCQ-------AWQDWPLTQVTFYRDGSALGPPGPNR-----EFS 135
               ::...|.:.||.|:.:.|.|.       .|..:     ::.:||..   ..|:|     |.|
Zfish    59 ---VVKVSPDQHVFIGETVTLTCDIQTGGNIQWIGY-----SWIKDGDT---HNPHRTTSAAELS 112

Human   136 ITVVQKADSGHYHCSGIFQSPGPGIPETASVVAITVQELFPAPILRAVPSAEPQAGSPMTLSCQT 200
            ...|..:.||.|.|.|  :.......:.:..:.:||..| |...:...|.:.......:.|:|  
Zfish   113 FRAVSASVSGQYSCRG--ERSDSQRSDISDTLTLTVSAL-PRSRVTVTPDSAVFTEETVNLTC-- 172

Human   201 KLPLQRSAARLLFSFYK---------DGRIVQSRGLSSEFQIPTASEDHSGSYWCEAATEDNQVW 256
              .::...:...:.:||         |||...:|   ....|..|:|...|.|||..........
Zfish   173 --VIESDHSDWTYEWYKDRNSVNLQSDGRYTVNR---DTLTIRGAAESDQGQYWCRGQRSGRPNS 232

Human   257 KQSP---QLEIRVQGAS----SSAAPPTLNPAPQKSAAPG 289
            .||.   .|.::|:|.|    |..:..|..|.|...|.||
Zfish   233 SQSSSAVSLSVKVKGISKIHFSLLSCFTALPMPTLHARPG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRLANP_001171795.2 Ig 85..152 CDD:353325 18/78 (23%)
Ig_2 177..266 CDD:316418 19/100 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..319 9/28 (32%)
si:ch211-165f21.7XP_021333783.1 Ig 58..146 CDD:325142 20/106 (19%)
Ig_3 153..223 CDD:316449 15/76 (20%)
Ig_3 265..336 CDD:316449 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9806
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.