DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NAA11 and CG31730

DIOPT Version :9

Sequence 1:NP_116082.1 Gene:NAA11 / 84779 HGNCID:28125 Length:229 Species:Homo sapiens
Sequence 2:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster


Alignment Length:154 Identity:51/154 - (33%)
Similarity:81/154 - (52%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     2 NIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSY--IAEDEDGKIVGYVLAKMEEEP 64
            :.|..:.|||..:.......|.|.|.:.:::.|.|.:|.||.  ||...||:.:||:..:.:.:.
  Fly     3 SFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQVKR 67

Human    65 DDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENF-NAKYVSLHVRKSNRPALHLYSNTLNF 128
            :..|:||:.:|.|...:||||||..|||  ...|:.:. .|.||:|.:|.|||.|..||: :|.:
  Fly    68 NQDPYGHVAALTVSPEYRRLGLATALMD--FFFMVSDLKGASYVNLFMRISNRAAYQLYT-SLGY 129

Human   129 QISEVEPKYYAD---GEDAYAMKR 149
            ...:....||.|   .|.||.:::
  Fly   130 AHRQTFLDYYPDEPKPESAYELRK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NAA11NP_116082.1 RimI 1..149 CDD:223532 51/152 (34%)
Interaction with NAA15. /evidence=ECO:0000250 1..58 18/57 (32%)
Acetyltransf_1 47..122 CDD:278980 28/75 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..229
CG31730NP_723799.1 rimI 9..141 CDD:273701 46/134 (34%)
Acetyltransf_1 52..129 CDD:278980 31/79 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S458
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.660

Return to query results.
Submit another query.