DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCGF1 and SPCC548.05c

DIOPT Version :9

Sequence 1:NP_116062.2 Gene:PCGF1 / 84759 HGNCID:17615 Length:259 Species:Homo sapiens
Sequence 2:NP_587745.1 Gene:SPCC548.05c / 2539314 PomBaseID:SPCC548.05c Length:468 Species:Schizosaccharomyces pombe


Alignment Length:226 Identity:47/226 - (20%)
Similarity:78/226 - (34%) Gaps:66/226 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     4 PQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKD----------LNEHIVCCLCAGYFVDAT 58
            ||......|.....|:   ||...:.:..|.:.:|.|          :.:.:.|.:|........
pombe    35 PQSNSTTFASSDATQM---YKKSRISSNSENKKQIPDTKTLLETFQKIKKTLECPICTEALQRPF 96

Human    59 TITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRI 123
            | |.|.||:|..|::.:|:.||.||.|..|:: |||.....:..:|..:                
pombe    97 T-THCGHTYCYECLLNWLKESKSCPTCRQKLY-TQPSPAYLVYEIMNVV---------------- 143

Human   124 REFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKN--KSV 186
                                |.||.|.|....:.:.|     .:|..:..:.:...:|.:  :|:
pombe   144 --------------------AASNSGFPLVGINENPA-----KKQKEVLFDGMFKQEDSHYPRSI 183

Human   187 LQNKYVRCSVRAEVRHLRRVLCHRLMLNPQH 217
            |        |.:|...||...|...:.||.|
pombe   184 L--------VDSEDGVLRCARCQWELENPYH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCGF1NP_116062.2 RING-HC_PCGF1 44..86 CDD:319647 14/41 (34%)
RING-HC finger (C3HC4-type) 47..85 CDD:319647 14/37 (38%)
Required for repressor activity 86..247 23/134 (17%)
Required for the interaction with the KDM2B-SKP1 heterodimeric complex. /evidence=ECO:0000269|PubMed:27568929 150..255 14/70 (20%)
RAWUL_PCGF1 166..253 CDD:340601 12/54 (22%)
RING-finger and WD40-associated ubiquitin-like domain (RAWUL), sufficient for interaction with BCOR and BCORL1. /evidence=ECO:0000269|PubMed:23523425, ECO:0000269|PubMed:27568929 167..255 12/53 (23%)
SPCC548.05cNP_587745.1 RING 84..126 CDD:238093 15/42 (36%)
COG2888 <193..213 CDD:268082 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.