DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment OGT and Spag1

DIOPT Version :9

Sequence 1:	NP_858058.1	Gene:	OGT / 8473	HGNCID:	8127	Length:	1046	Species:	Homo sapiens
Sequence 2:	NP_651514.1	Gene:	Spag1 / 43239	FlyBaseID:	FBgn0039463	Length:	469	Species:	Drosophila melanogaster

Alignment Length:	133	Identity:	30/133 - (22%)
Similarity:	52/133 - (39%)	Gaps:	20/133 - (15%)

- Green bases have known domain annotations that are detailed below.

Human   330 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTF 394
            |.||:.:::||                   ||..|....:...:..:.:.|:..|..:|...|..
  Fly   217 LKNLSQLEKEQ-------------------FAERHRLRGNESFKAKEYENAIEEYNCSIIYDPEN 262

Human   395 A-DAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKL 458
            | .||:|......:::....|:......:||:|....||..:|..|...|...|::..|:..|..
  Fly   263 AVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDF 327

Human   459 KPD 461
            :||
  Fly   328 EPD 330

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
OGT	NP_858058.1	TPR 1	21..54
		PEP_TPR_lipo	<22..>465	CDD:274350	30/133 (23%)
		TPR repeat	24..49	CDD:276809
		TPR repeat	57..83	CDD:276809
		TPR 2	89..122
		TPR repeat	89..117	CDD:276809
		TPR repeat	122..152	CDD:276809
		TPR 3	123..156
		TPR 4	157..190
		TPR repeat	157..185	CDD:276809
		TPR 5	191..224
		TPR repeat	191..219	CDD:276809
		TPR 6	225..258
		TPR repeat	226..253	CDD:276809
		TPR 7	259..292
		TPR repeat	259..287	CDD:276809
		TPR 8	293..326
		TPR repeat	293..321	CDD:276809
		TPR 9	327..360		5/29 (17%)
		TPR repeat	327..355	CDD:276809	5/24 (21%)
		TPR repeat	360..390	CDD:276809	6/29 (21%)
		TPR 10	361..394		6/32 (19%)
		TPR 11	395..428		8/33 (24%)
		TPR repeat	395..423	CDD:276809	5/28 (18%)
		TPR 12	429..462		10/33 (30%)
		TPR repeat	429..457	CDD:276809	7/27 (26%)
		TPR 13, truncated	463..473
		Nuclear localization signal. /evidence=ECO:0000255	487..503
		Glyco_transf_41	556..1024	CDD:372753
		Required for phosphatidylinositol 3,4,5-triphosphate binding	991..1010
Spag1	NP_651514.1	TPR_11	229..295	CDD:290150	13/65 (20%)
		TPR repeat	229..257	CDD:276809	4/27 (15%)
		TPR repeat	262..293	CDD:276809	5/30 (17%)
		TPR_11	266..329	CDD:290150	15/62 (24%)
		TPR	266..297	CDD:197478	7/30 (23%)
		TPR repeat	298..326	CDD:276809	7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810