| Sequence 1: | NP_858058.1 | Gene: | OGT / 8473 | HGNCID: | 8127 | Length: | 1046 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610636.1 | Gene: | BBS4 / 36167 | FlyBaseID: | FBgn0033578 | Length: | 486 | Species: | Drosophila melanogaster |
| Alignment Length: | 339 | Identity: | 69/339 - (20%) |
|---|---|---|---|
| Similarity: | 133/339 - (39%) | Gaps: | 50/339 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Human 198 GCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRA--LSLSPNHAV 260
Human 261 VH--GNL--------------------ACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANAL 303
Human 304 KEKGSVAEAEDCYNTALRLCPTHADSLNNLA-------NIKREQGNIEEAVRLYRKALEVFPEFA 361
Human 362 AAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINP 426
Human 427 AFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVS 491
Human 492 IVADQLEKNRLPSV 505 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| OGT | NP_858058.1 | TPR 1 | 21..54 | ||
| PEP_TPR_lipo | <22..>465 | CDD:274350 | 59/297 (20%) | ||
| TPR repeat | 24..49 | CDD:276809 | |||
| TPR repeat | 57..83 | CDD:276809 | |||
| TPR 2 | 89..122 | ||||
| TPR repeat | 89..117 | CDD:276809 | |||
| TPR repeat | 122..152 | CDD:276809 | |||
| TPR 3 | 123..156 | ||||
| TPR 4 | 157..190 | ||||
| TPR repeat | 157..185 | CDD:276809 | |||
| TPR 5 | 191..224 | 7/25 (28%) | |||
| TPR repeat | 191..219 | CDD:276809 | 5/20 (25%) | ||
| TPR 6 | 225..258 | 7/34 (21%) | |||
| TPR repeat | 226..253 | CDD:276809 | 6/28 (21%) | ||
| TPR 7 | 259..292 | 9/54 (17%) | |||
| TPR repeat | 259..287 | CDD:276809 | 9/49 (18%) | ||
| TPR 8 | 293..326 | 7/32 (22%) | |||
| TPR repeat | 293..321 | CDD:276809 | 4/27 (15%) | ||
| TPR 9 | 327..360 | 6/39 (15%) | |||
| TPR repeat | 327..355 | CDD:276809 | 5/34 (15%) | ||
| TPR repeat | 360..390 | CDD:276809 | 6/29 (21%) | ||
| TPR 10 | 361..394 | 7/32 (22%) | |||
| TPR 11 | 395..428 | 6/32 (19%) | |||
| TPR repeat | 395..423 | CDD:276809 | 5/27 (19%) | ||
| TPR 12 | 429..462 | 8/32 (25%) | |||
| TPR repeat | 429..457 | CDD:276809 | 7/27 (26%) | ||
| TPR 13, truncated | 463..473 | 2/9 (22%) | |||
| Nuclear localization signal. /evidence=ECO:0000255 | 487..503 | 3/15 (20%) | |||
| Glyco_transf_41 | 556..1024 | CDD:372753 | |||
| Required for phosphatidylinositol 3,4,5-triphosphate binding | 991..1010 | ||||
| BBS4 | NP_610636.1 | TPR_12 | 63..127 | CDD:290160 | 12/52 (23%) |
| TPR repeat | 68..95 | CDD:276809 | 5/20 (25%) | ||
| TPR_12 | 97..175 | CDD:290160 | 17/82 (21%) | ||
| TPR repeat | 100..130 | CDD:276809 | 6/29 (21%) | ||
| TPR repeat | 136..175 | CDD:276809 | 9/43 (21%) | ||
| TPR repeat | 179..209 | CDD:276809 | 5/37 (14%) | ||
| TPR_19 | 190..254 | CDD:291240 | 10/66 (15%) | ||
| TPR repeat | 214..242 | CDD:276809 | 2/27 (7%) | ||
| TPR repeat | 249..277 | CDD:276809 | 7/30 (23%) | ||
| TPR_11 | 283..348 | CDD:290150 | 14/64 (22%) | ||
| TPR repeat | 283..311 | CDD:276809 | 5/27 (19%) | ||
| TPR repeat | 316..346 | CDD:276809 | 7/29 (24%) | ||
| TPR repeat | 351..377 | CDD:276809 | 5/25 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||