Sequence 1: | NP_858058.1 | Gene: | OGT / 8473 | HGNCID: | 8127 | Length: | 1046 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
Alignment Length: | 465 | Identity: | 125/465 - (26%) |
---|---|---|---|
Similarity: | 184/465 - (39%) | Gaps: | 107/465 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 74 SAHFSTLAIKQN------PLLAEAY--------SNL----GNVYKER-----------------G 103
Human 104 QL-QEAIEHYRHALRLKPDFIDGYINLAAALVAAG--------DMEGAVQAYVSALQYNPDLYCV 159
Human 160 RSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF 224
Human 225 LDAYINLGNVL-----------------------------------------------KEARIFD 242
Human 243 RAVA--AYLRALSLSP--NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANAL 303
Human 304 KEKGS-VAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNL 367
Human 368 ASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAH 432
Human 433 SNLA--SIHK 440 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
OGT | NP_858058.1 | TPR 1 | 21..54 | ||
PEP_TPR_lipo | <22..>465 | CDD:274350 | 125/465 (27%) | ||
TPR repeat | 24..49 | CDD:276809 | |||
TPR repeat | 57..83 | CDD:276809 | 4/8 (50%) | ||
TPR 2 | 89..122 | 14/62 (23%) | |||
TPR repeat | 89..117 | CDD:276809 | 12/57 (21%) | ||
TPR repeat | 122..152 | CDD:276809 | 8/37 (22%) | ||
TPR 3 | 123..156 | 10/40 (25%) | |||
TPR 4 | 157..190 | 10/32 (31%) | |||
TPR repeat | 157..185 | CDD:276809 | 9/27 (33%) | ||
TPR 5 | 191..224 | 13/32 (41%) | |||
TPR repeat | 191..219 | CDD:276809 | 11/27 (41%) | ||
TPR 6 | 225..258 | 15/83 (18%) | |||
TPR repeat | 226..253 | CDD:276809 | 12/75 (16%) | ||
TPR 7 | 259..292 | 11/32 (34%) | |||
TPR repeat | 259..287 | CDD:276809 | 8/27 (30%) | ||
TPR 8 | 293..326 | 13/33 (39%) | |||
TPR repeat | 293..321 | CDD:276809 | 10/28 (36%) | ||
TPR 9 | 327..360 | 8/32 (25%) | |||
TPR repeat | 327..355 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 360..390 | CDD:276809 | 8/29 (28%) | ||
TPR 10 | 361..394 | 9/32 (28%) | |||
TPR 11 | 395..428 | 10/32 (31%) | |||
TPR repeat | 395..423 | CDD:276809 | 9/27 (33%) | ||
TPR 12 | 429..462 | 6/14 (43%) | |||
TPR repeat | 429..457 | CDD:276809 | 6/14 (43%) | ||
TPR 13, truncated | 463..473 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 487..503 | ||||
Glyco_transf_41 | 556..1024 | CDD:372753 | |||
Required for phosphatidylinositol 3,4,5-triphosphate binding | 991..1010 | ||||
CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
TPR_11 | 518..583 | CDD:290150 | 22/66 (33%) | ||
TPR repeat | 518..546 | CDD:276809 | 9/29 (31%) | ||
TPR repeat | 551..581 | CDD:276809 | 11/29 (38%) | ||
TPR_1 | 552..584 | CDD:278916 | 12/31 (39%) | ||
TPR | 565..841 | CDD:223533 | 73/275 (27%) | ||
TPR repeat | 586..611 | CDD:276809 | 6/24 (25%) | ||
TPR repeat | 634..660 | CDD:276809 | 4/25 (16%) | ||
TPR repeat | 671..699 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 704..735 | CDD:276809 | 11/30 (37%) | ||
TPR repeat | 740..768 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 773..803 | CDD:276809 | 8/29 (28%) | ||
TPR | 808..841 | CDD:197478 | 10/32 (31%) | ||
TPR repeat | 808..836 | CDD:276809 | 9/27 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |