DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OGT and CG4341

DIOPT Version :9

Sequence 1:NP_858058.1 Gene:OGT / 8473 HGNCID:8127 Length:1046 Species:Homo sapiens
Sequence 2:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster


Alignment Length:427 Identity:113/427 - (26%)
Similarity:183/427 - (42%) Gaps:80/427 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    59 LLLSSIHFQCRRL------DRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALR 117
            |||:::..:..|.      :.|.:.|.:||  ||  .:|..|||:|...:|:.:||.:..:.|:|
  Fly   570 LLLAAMSLRTLRRNADWRDEESLYRSAIAI--NP--PKALGNLGSVLSSQGRYEEAKQVLQEAIR 630

Human   118 LKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLK 182
            .:|:..|.:.||       |.:....|.|.:|::                           |:.:
  Fly   631 FRPNMADVHFNL-------GILHQNQQVYPAAVE---------------------------CFQR 661

Human   183 AIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRA-VA 246
            ||:.:||.|||:.|||..|.|.|:...||...:....||          |..:::....|:| .:
  Fly   662 AIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLD----------GAAVRDRTAHDQARSS 716

Human   247 AYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPD----AYCNLANALKEKG 307
            |||:              |..:|.|||.:..|:..||.|:...|..|.    .|..:.:.|....
  Fly   717 AYLQ--------------LGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQ 767

Human   308 SVAEAEDCYNTALRLCPTH-ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVL 371
            ...|||..:..||.|.|.. |..|:....:.|......||...:::||::.||.|:.:.:.|..|
  Fly   768 QWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFL 832

Human   372 QQQGKLQEALMHYKEAIRISP---TFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHS 433
            ..|.:..|:.::::.|..::|   |...|.:.....|....|.:   ..|.:|:.:.|..|.||:
  Fly   833 SLQSRHHESAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAE---MWYRKAVALRPGDAHAHT 894

Human   434 NLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLA 470
            ||.:|....|....|.|||:.||:|:|.......|||
  Fly   895 NLGAILHLLGRTNHAAASYKAALRLQPGDAITLGNLA 931

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OGTNP_858058.1 TPR 1 21..54
PEP_TPR_lipo <22..>465 CDD:274350 110/420 (26%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809 7/29 (24%)
TPR 2 89..122 11/32 (34%)
TPR repeat 89..117 CDD:276809 9/27 (33%)
TPR repeat 122..152 CDD:276809 7/29 (24%)
TPR 3 123..156 7/32 (22%)
TPR 4 157..190 4/32 (13%)
TPR repeat 157..185 CDD:276809 2/27 (7%)
TPR 5 191..224 13/32 (41%)
TPR repeat 191..219 CDD:276809 11/27 (41%)
TPR 6 225..258 6/33 (18%)
TPR repeat 226..253 CDD:276809 6/27 (22%)
TPR 7 259..292 10/32 (31%)
TPR repeat 259..287 CDD:276809 9/27 (33%)
TPR 8 293..326 10/36 (28%)
TPR repeat 293..321 CDD:276809 7/31 (23%)
TPR 9 327..360 8/32 (25%)
TPR repeat 327..355 CDD:276809 6/27 (22%)
TPR repeat 360..390 CDD:276809 6/29 (21%)
TPR 10 361..394 7/35 (20%)
TPR 11 395..428 6/32 (19%)
TPR repeat 395..423 CDD:276809 5/27 (19%)
TPR 12 429..462 15/32 (47%)
TPR repeat 429..457 CDD:276809 12/27 (44%)
TPR 13, truncated 463..473 3/8 (38%)
Nuclear localization signal. /evidence=ECO:0000255 487..503
Glyco_transf_41 556..1024 CDD:372753
Required for phosphatidylinositol 3,4,5-triphosphate binding 991..1010
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 21/98 (21%)
TPR_1 602..634 CDD:278916 10/31 (32%)
TPR repeat 602..630 CDD:276809 9/27 (33%)
TPR repeat 635..665 CDD:276809 10/63 (16%)
TPR_11 636..700 CDD:290150 23/97 (24%)
TPR_1 636..668 CDD:278916 10/65 (15%)
TPR repeat 670..694 CDD:276809 11/23 (48%)
TPR_11 714..784 CDD:290150 22/83 (27%)
TPR repeat 715..743 CDD:276809 12/41 (29%)
TPR repeat 748..782 CDD:276809 8/33 (24%)
TPR_11 755..819 CDD:290150 16/63 (25%)
TPR repeat 787..816 CDD:276809 6/28 (21%)
TPR_11 821..887 CDD:290150 13/68 (19%)
TPR repeat 822..850 CDD:276809 6/27 (22%)
TPR repeat 855..885 CDD:276809 6/32 (19%)
TPR_11 <874..921 CDD:290150 18/49 (37%)
TPR repeat 890..918 CDD:276809 12/27 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.