DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LNX1 and CG15803

DIOPT Version :9

Sequence 1:NP_001119800.1 Gene:LNX1 / 84708 HGNCID:6657 Length:728 Species:Homo sapiens
Sequence 2:NP_001287388.1 Gene:CG15803 / 42206 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster


Alignment Length:569 Identity:120/569 - (21%)
Similarity:205/569 - (36%) Gaps:166/569 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   263 LYHLIPDGEITSIKINRVDPSESLSI-------RLVGG-SETPLVHIIIQHIYRDGVIARDGRLL 319
            |..|:..|.....:::.|:|..|.::       .|.|. ::.||..|                  
  Fly   164 LVGLVRGGPAEGTELSAVEPQPSAAVLQLQQLSELAGDLADFPLPPI------------------ 210

Human   320 PG----DIILKVNG-------MDISNVPHNY-------AVRLLRQPCQVLWL----------TVM 356
            ||    .::...|.       :|:..||.:.       |:::|  |.:..|.          ||:
  Fly   211 PGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPPPRPALQML--PLETQWRCVQDQNRHIETVI 273

Human   357 REQKFR----------SRNNGQAPDAY--RPRDDSFHVILNKSSPEEQLGIKLVRKV----DEPG 405
            .:.|.:          |.:...:||:|  .|..:::.|.|:|:  ...|||.:...|    |..|
  Fly   274 ADSKRKLLANEDGGSASASGSGSPDSYMDSPETETYVVELHKN--VYGLGITVAGYVCEEEDLSG 336

Human   406 VFIFNVLDGGVAYRHGQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPD 470
            :|:.::::|..|...||::.|||::|::|..|...:...|..|::.::..|||.:.|.:|.|..:
  Fly   337 IFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKYE 401

Human   471 IFQEAGWNSNGSWSPGPGERSNTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPI 535
            ..|.|.....|:.:|...:||.                  .||..:...:::.|..|       |
  Fly   402 HLQVALTEIKGTSAPSGLDRSQ------------------DKDQDQESQLSMPGSPS-------I 441

Human   536 YVISVEPGGVISRDGRIKTGDILLNVDGV-------ELTEVSRSEAVA-----LLKRTSSSIVLK 588
            ..:|..|...:..|.....||..::.:.|       |..|:...:.|.     :|.|:..|..|.
  Fly   442 ATLSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIELPSRDTVESNMSHVLDRSDHSGGLT 506

Human   589 ALEVKEYEP--------------------QEDCSSPAAL-------------------DSNHNMA 614
            ..:|....|                    .|.|:.|...                   |:..:..
  Fly   507 KDQVPRISPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKPETERVKDLGDTKTDTD 571

Human   615 PPSDWSPSWVMWLELPRCLYNCKDIVLRRNTAG-------SLGFCIVGGYEEYNG--NKP-FFIK 669
            |..|..|.     ::|... |...:.....||.       |||..:.|..:...|  .:| .:|:
  Fly   572 PDPDLDPG-----QMPTPT-NEAPVKAASPTAASLRVAWKSLGISLEGTVDVECGIEKRPHHYIR 630

Human   670 SIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITL 718
            ||:...|....|.:|.||.||.||.....|:.|..:.::||||..|:.|
  Fly   631 SILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKL 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LNX1NP_001119800.1 mRING-HC-C3HC3D_LNX1 38..79 CDD:319693
modified RING-HC finger (C3HC3D-type) 41..78 CDD:319693
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
NPXY motif 181..184
Interaction with MAGEB18. /evidence=ECO:0000269|PubMed:20864041 186..244
PDZ_signaling 272..355 CDD:238492 18/118 (15%)
PDZ_signaling 380..460 CDD:238492 25/83 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..494 5/18 (28%)
PDZ_signaling 505..588 CDD:238492 17/94 (18%)
PDZ_signaling 637..721 CDD:238492 28/92 (30%)
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 25/87 (29%)
PDZ_signaling 605..680 CDD:238492 26/75 (35%)
PDZ 773..858 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19964
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.