DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LNX1 and Syn1

DIOPT Version :9

Sequence 1:	NP_001119800.1	Gene:	LNX1 / 84708	HGNCID:	6657	Length:	728	Species:	Homo sapiens
Sequence 2:	NP_001262192.1	Gene:	Syn1 / 40424	FlyBaseID:	FBgn0037130	Length:	627	Species:	Drosophila melanogaster

Alignment Length:	129	Identity:	34/129 - (26%)
Similarity:	56/129 - (43%)	Gaps:	14/129 - (10%)

- Green bases have known domain annotations that are detailed below.

Human   478 NSNGSWSPGPGERSNT---------PKPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDL 533
            |.||...|.....:|.         ..|.|  :...::.|.|.|.....||:::.||..:|   :
  Fly   128 NDNGDRDPCLNNNNNAGDGGGMDMCDVPDH--VANQKRHVRIIKSDNNGLGISIKGGRENR---M 187

Human   534 PIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEYEP 597
            ||.:..:..|....:...:..||.:|.|:|.||.:.:..|||..|||:...:.|:...::|..|
  Fly   188 PILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTP 251

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LNX1	NP_001119800.1	mRING-HC-C3HC3D_LNX1	38..79	CDD:319693
		modified RING-HC finger (C3HC3D-type)	41..78	CDD:319693
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	178..214
		NPXY motif	181..184
		Interaction with MAGEB18. /evidence=ECO:0000269\|PubMed:20864041	186..244
		PDZ_signaling	272..355	CDD:238492
		PDZ_signaling	380..460	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	475..494		5/24 (21%)
		PDZ_signaling	505..588	CDD:238492	24/82 (29%)
		PDZ_signaling	637..721	CDD:238492
Syn1	NP_001262192.1	PH-like	30..>61	CDD:302622
		PDZ_signaling	163..244	CDD:238492	25/83 (30%)
		PHsplit_syntrophin	<293..351	CDD:269960
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810