DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP6 and Fkbp12

DIOPT Version :10

Sequence 1:NP_003593.3 Gene:FKBP6 / 8468 HGNCID:3722 Length:327 Species:Homo sapiens
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:99 Identity:35/99 - (35%)
Similarity:56/99 - (56%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    51 VAP-DAS--------VLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGE 106
            :|| |.|        |.|.|:|.|:...: |||:..|..|....:|:...:.|.:.|:..:..|:
  Fly     8 IAPGDGSTYPKNGQKVTVHYTGTLDDGTK-FDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQ 71

Human   107 LARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL 140
            .|:.:..|:||||:.|.|.:||||:|:.|::|||
  Fly    72 RAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP6NP_003593.3 FKBP_C 51..140 CDD:459735 33/97 (34%)
TPR 1 171..204
TPR 2 219..252
TPR 221..>302 CDD:440225
TPR repeat 221..247 CDD:276809
TPR repeat 252..282 CDD:276809
TPR 3 253..286
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 35/99 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.