DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP6 and CG1847

DIOPT Version :9

Sequence 1:NP_003593.3 Gene:FKBP6 / 8468 HGNCID:3722 Length:327 Species:Homo sapiens
Sequence 2:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster


Alignment Length:305 Identity:67/305 - (21%)
Similarity:112/305 - (36%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    38 VLKDVIREGAGDL-VAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLS 101
            :.|:::..|...: :.|...|...:........|..|.:...:.|..:.||:...|...||.:..
  Fly    12 IRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWELIVQQ 76

Human   102 MRRGELARFLF--------------------KP------------NYAYGTLGCPPLIPPNTTVL 134
            |...|:|:|..                    ||            |...|......|:...:.:.
  Fly    77 MSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTLQNEGIGYTDLDELLQNPSDLE 141

Human   135 FEIELLDFLDCAESDKFCALSAEQQDQFPLQK-------VLKVAATEREFGNYLFRQNRFYDAKV 192
            |.|||              .|.|..:|:..::       .:...:|.||.||..::.:||.:|:.
  Fly   142 FIIEL--------------FSIELPEQYEKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAET 192

Human   193 RYKRAL-----LLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKN 252
            .|:.|:     |:|:.:....|.|.|. |.|.|:|||.:...|........:.:..:.|.:|.:|
  Fly   193 CYREAVGIVEQLMLKEKPHDEEWQELA-AIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRN 256

Human   253 AKALFRCGQA-CLLLTEYQKARDFLVRAQKEQPFNHDINNELKKL 296
            .|||||..:| .......|..||||.....:......::.|||.:
  Fly   257 VKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP6NP_003593.3 FKBP_C 51..140 CDD:306713 22/120 (18%)
TPR <164..315 CDD:223533 39/146 (27%)
TPR 1 171..204 12/37 (32%)
TPR 2 219..252 7/32 (22%)
TPR repeat 221..247 CDD:276809 4/25 (16%)
TPR repeat 252..282 CDD:276809 12/30 (40%)
TPR 3 253..286 11/33 (33%)
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 14/68 (21%)
3a0801s09 150..>308 CDD:273380 41/153 (27%)
TPR repeat 173..217 CDD:276809 13/43 (30%)
TPR repeat 222..252 CDD:276809 7/29 (24%)
TPR repeat 257..285 CDD:276809 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.